OPCML Polyclonal antibody

• 

  WB analysis using 17962-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17962-1-AP (OPCML antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of rat brain using 17962-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 17962-1-AP (OPCML antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 17962-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 17962-1-AP (OPCML antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse brain using 17962-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using OPCML antibody (17962-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

OPCML Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 17962-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

Synonyms

IgLON family member 1, IGLON1, OBCAM, Opioid-binding cell adhesion molecule, Opioid-binding protein/cell adhesion molecule

---

Tested Applications

• Positive WB detected in: mouse pancreas tissue, rat pancreas tissue
• Positive IHC detected in: rat brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below

Product Information

17962-1-AP targets OPCML in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12560

  Product name: Recombinant human OPCML protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 27-345 aa of BC074773

  Sequence: TGVPVRSGDATFPKAMDNVTVRQGESATLRCTIDDRVTRVAWLNRSTILYAGNDKWSIDPRVIILVNTPTQYSIMIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVPPQIMNISSDITVNEGSSVTLLCLAIGRPEPTVTWRHLSVKEGQGFVSEDEYLEISDIKRDQSGEYECSALNDVAAPDVRKVKITVNYPPYISKAKNTGVSVGQKGILSCEASAVPMAEFQWFKEETRLATGLDGMRIENKGRMSTLTFFNVSEKDYGNYTCVATNKLGNTNASITLYGPGAVIDGVNSASRALACLWLSGTLLAHFFIKF

• Full Name: opioid binding protein/cell adhesion molecule-like
• Calculated Molecular Weight: 345 aa, 38 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC074773
• Gene Symbol: OPCML
• Gene ID (NCBI): 4978
• RRID: AB_2935445
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14982
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

OPCML, also called opioid-binding cell adhesion molecule (OBCAM), belongs to the IgLON limbic system-associated membrane protein (LSAMP, OPCML/OBCAM, neurotrimin) family of IgG domain containing glycosylphosphatidylinositol-anchored cell adhesion molecules. Originally isolated from brain, OPCMLis also expressed in stomach, ovary, heart, placenta, testis, kidney, liver, pancreas and colon. OPCML has been identified as a tumour suppressor, which inhibited tumor growth in some cancers including ovarian cancer, lung cancer and prostate cancer (PMID: 19176311; 28407749).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Oncol; Downregulation of OPCML is associated with activation of AKT signaling and aggressive phenotypes in glioblastoma cells.; Authors - Zhixin Liu ; KD Validated