OPN1SW Recombinant monoclonal antibody, PBS Only

• 

  IHC staining of mouse eye using 83754-6-RR (same clone as 83754-6-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse eye tissue slide using 83754-6-RR (OPN1SW antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83754-6-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse eye using 83754-6-RR (same clone as 83754-6-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse eye tissue using OPN1SW antibody (83754-6-RR, Clone: 240714A5 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 83754-6-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83754-6-RR

  Biolayer interferometry (BLl) kinetic assays of 83754-6-RR against Human OPN1SW were performed. The affinity constant is 3.58 nM.

OPN1SW Uni-rAb^® Recombinant Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 83754-6-PBS

Clone No.240714A5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

240714A5, Blue sensitive opsin, Blue-sensitive opsin, BOP, CBT

---

Product Information

83754-6-PBS targets OPN1SW in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag20445

  Product name: Recombinant human OPN1SW protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 265-348 aa of BC156719

  Sequence: YAAFAMYMVNNRNHGLDLRLVTIPSFFSKSACIYNPIIYCFMNKQFQACIMKMVCGKAMTDESDTCSSQKTEVSTVSSTQVGPN

• Full Name: opsin 1 (cone pigments), short-wave-sensitive
• Calculated Molecular Weight: 348 aa, 39 kDa
• GenBank Accession Number: BC156719
• Gene Symbol: OPN1SW
• Gene ID (NCBI): 611
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P03999
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

OPN1SW (Short-wave-sensitive opsin 1) belongs to the G-protein coupled receptor 1 family, opsin subfamily. It's one of three types of cone photoreceptors responsible for normal color vision. Inherited tritan color vision deficiencies exhibit an autosomal dominant inheritance pattern and are caused by mutations in OPN1SW (PMID: 32400513).