Tested Applications
| Positive IF-P detected in | mouse eye tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25251-1-AP targets OPN5 in IF-P, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19384 Product name: Recombinant human OPN5 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 263-354 aa of BC126198 Sequence: IAWIPYAVVSVWSAFGRPDSIPIQLSVVPTLLAKSAAMYNPIIYQVIDYKFACCQTGGLKATKKKSLEGFRLHTVTTVRKSSAVLEIHEEWE Predict reactive species |
| Full Name | opsin 5 |
| Calculated Molecular Weight | 354 aa, 40 kDa |
| GenBank Accession Number | BC126198 |
| Gene Symbol | OPN5 |
| Gene ID (NCBI) | 221391 |
| RRID | AB_3669465 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6U736 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Neuropsin (OPN5) is an opsin family member known as a photopigment responsive to wavelengths in the near-UV (λmax = 380 nm) (PMID: 31607531). In mammals, OPN5 is required to photoentrainment the local circadian oscillator in the murine retina and cornea (PMID: 21135214).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for OPN5 antibody 25251-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



