OVGP1 Polyclonal antibody, PBS Only

• 

  WB analysis using 22324-1-AP (same clone as 22324-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 22324-1-AP (OVGP1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22324-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse ovary using 22324-1-AP (same clone as 22324-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 22324-1-AP (OVGP1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22324-1-PBS in a different storage buffer formulation.

OVGP1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 22324-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

22324-1-PBS targets OVGP1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17771

  Product name: Recombinant human OVGP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 329-678 aa of BC126177

  Sequence: VGYDNAISFSYKAWFIRREHFGGAMVWTLDMDDVRGTFCGTGPFPLVYVLNDILVRAEFSSTSLPQFWLSSAVNSSSTDPERLAVTTAWTTDSKILPPGGEAGVTEIHGKCENMTITPRGTTVTPTKETVSLGKHTVALGEKTEITGAMTMTSVGHQSMTPGEKALTPVGHQSVTTGQKTLTSVGYQSVTPGEKTLTPVGHQSVTPVSHQSVSPGGTTMTPVHFQTETLRQNTVAPRRKAVAREKVTVPSRNISVTPEGQTMPLRGENLTSEVGTHPRMGNLGLQMEAENRMMLSSSPVIQLPEQTPLAFDNRFVPIYGNHSSVNSVTPQTSPLSLKKEIPENSAVDEEA

• Full Name: oviductal glycoprotein 1, 120kDa
• Calculated Molecular Weight: 678 aa, 75 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC126177
• Gene Symbol: OVGP1
• Gene ID (NCBI): 5016
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q12889
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

OVGP1 (oviduct-specific glycoprotein, also known as MUC9) is a high molecular-weight glycoprotein thought to be exclusively secreted by the non-ciliated epithelial cells of the fallopian tube (PMID: 12444068). Identified first as an estrogen-induced secretory protein in the oviduct, OVGP1 aids in sperm capacitation, fertilization, and early embryonic development (PMID: 28883914). OVGP1 is the major non-serum protein present in OF (oviduct fluid) and its biological activity differs among species (PMID: 27601270).