OXGR1 Polyclonal antibody

• 

  WB analysis using 22069-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22069-1-AP (OXGR1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

OXGR1 Polyclonal Antibody for WB, ELISA

Cat No. 22069-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

2 oxoglutarate receptor 1, Alpha ketoglutarate receptor 1, G protein coupled receptor 80, G protein coupled receptor 99, GPR80

---

Tested Applications

• Positive WB detected in: A549 cells, Calu-1 cells, HeLa cells, NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22069-1-AP targets OXGR1 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17186

  Product name: Recombinant human OXGR1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 255-337 aa of BC103881

  Sequence: LPFHILRVIRIESRLLSISCSIENQIHEAYIVSRPLAALNTFGNLLLYVVVSDNFQQAVCSTVRCKVSGNLEQAKKISYSNNP

• Full Name: oxoglutarate (alpha-ketoglutarate) receptor 1
• Calculated Molecular Weight: 337 aa, 38 kDa
• Observed Molecular Weight: 38-42 kDa
• GenBank Accession Number: BC103881
• Gene Symbol: OXGR1
• Gene ID (NCBI): 27199
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96P68
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

2-oxoglutarate receptor 1(OXGR1) also known as GPR99, belongs to the G-protein coupled receptor family. OXGR1is expressed in renal cortical connecting tubule and collecting duct type B intercalated cells. When stimulated by its ligand, OXGR1 mediates cellular calcium uptake, which acts as a signal to promote the chloride-bicarbonate exchanger SLC26A4. Dominant loss-of-function OXGR1 variants are associated with recurrent calcium oxalate NL/NC disease(PMID: 36571463).