Occludin Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Occludin Polyclonal antibody (27260-1-AP)

Occludin Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), IP, ELISA

Cat No. 27260-1-AP

Publications(1307)

Reviews (4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (7)

Applications

WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), IP, ELISA

Synonyms

OCLN

• 

  WB analysis using 27260-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27260-1-AP (Occludin antibody) at dilution of 1:25000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 27260-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27260-1-AP (Occludin antibody) at dilution of 1:25000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 27260-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27260-1-AP (Occludin antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HUVEC using 27260-1-AP

  IP result of anti-Occludin (IP:27260-1-AP, 4ug; Detection:27260-1-AP 1:2000) with HUVEC cells lysate 840 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse colon using 27260-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 27260-1-AP (Occludin antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse colon using 27260-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 27260-1-AP (Occludin antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 27260-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 27260-1-AP (Occludin antibody) at dilution of 1:8000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 27260-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 27260-1-AP (Occludin antibody) at dilution of 1:8000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat colon using 27260-1-AP

  Immunohistochemical analysis of paraffin-embedded rat colon tissue slide using 27260-1-AP (Occludin antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse colon using 27260-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse colon tissue using Occludin antibody (27260-1-AP) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse brain using 27260-1-AP

  Immunofluorescent analysis of (4% PFA) fixed frozen OCT-embedded mouse brain tissue using Occludin antibody (27260-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of Caco-2 using 27260-1-AP

  Immunofluorescent analysis of (4% PFA) fixed Caco-2 cells using Occludin antibody (27260-1-AP) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), Alpha Tubulin antibody (66031-1-Ig, Clone: 1E4C11, red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of hTERT-RPE1 using 27260-1-AP

  Immunofluorescent analysis of (4% PFA) fixed hTERT-RPE1 cells using Occludin antibody (27260-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 27260-1-AP

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using Occludin antibody (27260-1-AP) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), Alpha Tubulin antibody (66031-1-Ig, Clone: 1E4C11, red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of Caco-2 using 27260-1-AP

  Immunofluorescent analysis of (4% PFA) fixed Caco-2 cells using Occludin antibody (27260-1-AP) at dilution of 1:1000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), Alpha Tubulin antibody (66031-1-Ig, Clone: 1E4C11, red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of MCF-7 using 27260-1-AP

  1x10^6 MCF-7 cells were intracellularly stained with 0.25 ug Occludin Polyclonal antibody (27260-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HUVEC cells, A431 cells, mouse kidney tissue, Caco-2 cells, mouse brain tissue, mouse colon tissue, rat colon tissue, rat brain tissue
• Positive IP detected in: HUVEC cells
• Positive IHC detected in: mouse colon tissue, human colon tissue, rat colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse colon tissue
• Positive IF-Fro detected in: mouse brain tissue
• Positive IF/ICC detected in: Caco-2 cells, MCF-7 cells, hTERT-RPE1 cells
• Positive FC (Intra) detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000
• Immunofluorescence (IF)-P: IF-P : 1:400-1:2000
• Immunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27260-1-AP targets Occludin in WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, pig, rabbit, canine, chicken, bovine, goat, duck
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26173

  Product name: Recombinant human Occludin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 360-522 aa of BC029886

  Sequence: VDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEEDWIREYPPITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT

• Full Name: occludin
• Calculated Molecular Weight: 522 aa, 59 kDa
• Observed Molecular Weight: 59 kDa, 53 kDa, 32 kDa, 23-25 kDa
• GenBank Accession Number: BC029886
• Gene Symbol: Occludin
• Gene ID (NCBI): 4950
• RRID: AB_2880820
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16625
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Occludin is an integral membrane protein located at the tight junction. It is a tetraspanin protein with four transmembrane domains, intracellular N and C termini, and two extracellular loops. Occludin plays a role in the formation and regulation of the tight junction paracellular permeability barrier. Occludin can exist in different isoforms, owing to modifications at the posttranscriptional and posttranslational levels, the monomeric occludin migrates as 53-65 kDa on SDS-PAGE (PMID: 22083955; 19457074).

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nature; Spermine is an endogenous iron chelator that inhibits ferroptosis; Authors - Man Li
mouse	WB,IF	Circulation; Microplastic Exposure Aggravates Cardiomyopathy Under Hemodynamic Stress Through the Gut-Heart Axis; Authors - Jing Wang
mouse	IHC	Cell Metab; Acetate enables metabolic fitness and cognitive performance during sleep disruption; Authors - Qinqin He
	WB	Cell Metab; Ketogenic diet alleviates septic lung injury via microbial gut-lung axis; Authors - Mingyuan Wei
mouse	WB	Exploration (Beijing); Ganoderic Acids Alleviate Neuroinflammation by Targeting Myeloid Differentiation Factor 2 for Ischemic Stroke Therapy.; Authors - Ang Ma
	IF	Gastroenterology; Structural Variations in Ulcerative Colitis-associated Escherichia coli Reduce Fructose Utilization and Aggravate Inflammation Under High-Fructose Diet; Authors - Xia Wu

Reviews

4.5 out of 5

4 verified customer reviews

What customers say

Automatically generated from the verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Kalliope (Verified Customer) (09-14-2026)

We stained pancreatic cancer cell lines grown on cover slips at 100% confluency with occludin to analyze tight junctions. Occludin is shown in the attached picture with red fluorescence. DAPI was used for nuclei. The antibody shows promise to work well, but at the moment there is alot of background and the nuclei are also stained.

• Applications: Immunofluorescence
• Cell Tissue Type: Pancreatic cancer cells

Occludin Antibody Immunofluorescence validation ( dilution) in Pancreatic cancer cells (Cat no:27260-1-AP)

Iram (Verified Customer) (06-13-2022)

Excellent antibody for immunoblotting

• Applications: Western Blot
• Primary Antibody Dilution: 1:2000
• Cell Tissue Type: colon cancer cells

Balawant (Verified Customer) (05-08-2022)

This antibody I have used and is working great . 1:2000 dilution is working great for the cell line (Colonic epithelialcellr of human).

• Applications: Western Blot
• Primary Antibody Dilution: 1:2000
• Cell Tissue Type: Human colonic epithelial cells and mice colon tissue

Kushal (Verified Customer) (03-14-2022)

• Applications: Western Blot, Immunoprecipitation, ChIP
• Primary Antibody Dilution: 1.2000
• Cell Tissue Type: Surgical human tissue, mouse tissue, Caco-2 cells