Tested Applications
| Positive IHC detected in | mouse testis tissue, human osteosarcoma tissue, human testis tissue, rat testis tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | U2OS cells, NIH/3T3 cells |
| Positive FC (Intra) detected in | NIH/3T3 cells, U2OS cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| IHC | See 108 publications below |
| IF | See 108 publications below |
Product Information
23418-1-AP targets Osteocalcin/OCN in IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, canine, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20065 Product name: Recombinant human Osteocalcin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 24-100 aa of BC113432 Sequence: KPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV Predict reactive species |
| Full Name | bone gamma-carboxyglutamate (gla) protein |
| Calculated Molecular Weight | 100 aa, 11 kDa |
| GenBank Accession Number | BC113432 |
| Gene Symbol | Osteocalcin |
| Gene ID (NCBI) | 632 |
| RRID | AB_2879275 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P02818 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Osteocalcin is a small, highly conserved molecule associated with mineralization of bone matrix. Osteocalcin is specifically expressed in osteoblasts and is the most abundant non-collagenous protein in bone. It regulates the dynamics of new bone formation and bone resorption by interaction with vitamin D, and by influencing the differentiation of osteoblasts. Osteocalcin is also involved in the posttranslational targeting of vitamin K-dependent gamma-carboxylation, which controls blood coagulation.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Osteocalcin/OCN antibody 23418-1-AP | Download protocol |
| IHC protocol for Osteocalcin/OCN antibody 23418-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Adv Mater Supramolecular Hydrogel with Ultra-Rapid Cell-Mediated Network Adaptation for Enhancing Cellular Metabolic Energetics and Tissue Regeneration | ||
Bioact Mater 3D Printed Biomimetic Metamaterials with Graded Porosity and Tapering Topology for Improved Cell Seeding and Bone Regeneration | ||
Bioact Mater Ultrasound-generated bubbles enhance osteogenic differentiation of mesenchymal stromal cells in composite collagen hydrogels | ||
ACS Nano Nanotopography Sequentially Mediates Human Mesenchymal Stem Cell-Derived Small Extracellular Vesicles for Enhancing Osteogenesis. | ||
Nat Commun Optogenetic activation of mechanical nociceptions to enhance implant osseointegration | ||
Biomaterials A nano-conductive osteogenic hydrogel to locally promote calcium influx for electro-inspired bone defect regeneration |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH CHAO (Verified Customer) (03-31-2022) | Weak bands around the correct size
|
FH LUNFENG (Verified Customer) (01-27-2020) | GOOD
|
FH Jie (Verified Customer) (01-23-2020) | Not working very well in my western blot
|
FH Canzhao (Verified Customer) (01-17-2020) | This antibody worked very well on western blot and immunofluorescence, very specific. I recommend this antibody!
|





































