Tested Applications
Positive IF/ICC detected in | NIH/3T3 cells |
Positive FC (Intra) detected in | NIH/3T3 cells |
Recommended dilution
Application | Dilution |
---|---|
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
CL594-23418 targets Osteocalcin/OCN in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag20065 Product name: Recombinant human Osteocalcin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 24-100 aa of BC113432 Sequence: KPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV Predict reactive species |
Full Name | bone gamma-carboxyglutamate (gla) protein |
Calculated Molecular Weight | 100 aa, 11 kDa |
GenBank Accession Number | BC113432 |
Gene Symbol | Osteocalcin |
Gene ID (NCBI) | 632 |
RRID | AB_2919870 |
Conjugate | CoraLite®594 Fluorescent Dye |
Excitation/Emission Maxima Wavelengths | 588 nm / 604 nm |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P02818 |
Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Protocols
Product Specific Protocols | |
---|---|
IF protocol for CL594 Osteocalcin/OCN antibody CL594-23418 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |