CoraLite®594-conjugated Osteocalcin/OCN Polyclonal antibody

• 

  IF Staining of NIH/3T3 using CL594-23418

  Immunofluorescent analysis of (-20°C Ethanol) fixed NIH/3T3 cells using CoraLite®594 Osteocalcin antibody (CL594-23418) at dilution of 1:400.

• 

  FC experiment of NIH/3T3 using CL594-23418

  1X10^6 NIH/3T3 cells were intracellularly stained with 0.5 ug CoraLite®594 Anti-Human Osteocalcin (CL594-23418) (red), or 0.5 ug CoraLite®594-conjugated Rabbit IgG control Rabbit PolyAb (CL594-30000, Clone: ) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

Osteocalcin/OCN Polyclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL594-23418

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC, FC (Intra)

Synonyms

BGLAP, Osteocalcin, BGP, Bone Gla protein, Gamma-carboxyglutamic acid-containing protein

---

Tested Applications

• Positive IF/ICC detected in: NIH/3T3 cells
• Positive FC (Intra) detected in: NIH/3T3 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-23418 targets Osteocalcin/OCN in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20065

  Product name: Recombinant human Osteocalcin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 24-100 aa of BC113432

  Sequence: KPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV

• Full Name: bone gamma-carboxyglutamate (gla) protein
• Calculated Molecular Weight: 100 aa, 11 kDa
• GenBank Accession Number: BC113432
• Gene Symbol: Osteocalcin
• Gene ID (NCBI): 632
• RRID: AB_2919870
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P02818
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.