Osteoprotegerin/TNFRSF11B Recombinant monoclonal antibody, PBS Only

• 

Osteoprotegerin/TNFRSF11B Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 83737-1-PBS

Clone No.240671A4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

OCIF, OPG, Osteoclastogenesis inhibitory factor, Osteoprotegerin, TNFRSF11B

---

Product Information

83737-1-PBS targets Osteoprotegerin/TNFRSF11B in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0976

  Product name: Recombinant Human Osteoprotegerin/TNFRSF11B protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 22-401 aa of NM_002546.4

  Sequence: ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL

• Full Name: tumor necrosis factor receptor superfamily, member 11b
• Calculated Molecular Weight: 46kDa
• GenBank Accession Number: NM_002546.4
• Gene Symbol: TNFRSF11B
• Gene ID (NCBI): 4982
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O00300
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.