P glycoprotein Monoclonal antibody, PBS Only

• 

  WB analysis of HeLa using 67258-2-Ig (same clone as 67258-2-PBS)

  unboiled HeLa cells were subjected to SDS PAGE followed by western blot with 67258-2-Ig (ABCB1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67258-2-PBS in a different storage buffer formulation.

• 

  WB analysis of SH-SY5Y using 67258-2-Ig (same clone as 67258-2-PBS)

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 67258-2-Ig (ABCB1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67258-2-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 67258-2-Ig (same clone as 67258-2-PBS)

  unboiled HepG2 cells were subjected to SDS PAGE followed by western blot with 67258-2-Ig (ABCB1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67258-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 67258-2-Ig (same clone as 67258-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 67258-2-Ig (ABCB1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67258-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 67258-2-Ig (same clone as 67258-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 67258-2-Ig (ABCB1 antibody) at dilution of 1:16000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67258-2-PBS in a different storage buffer formulation.

• 

  IF Staining of COLO 320 using 67258-2-Ig (same clone as 67258-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed COLO 320 cells using P glycoprotein antibody (67258-2-Ig, Clone: 1G6C2 ) at dilution of 1:1000 and Multi-rAb CoraLite® Plus 594-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (Cat.NO. RGAM004 ). This data was developed using the same antibody clone with 67258-2-PBS in a different storage buffer formulation.

P glycoprotein Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 67258-2-PBS

Clone No.1G6C2

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

ABCB1, 1G6C2, EC:7.6.2.2, EC:7.6.2.1, ATP-dependent translocase ABCB1

---

Product Information

67258-2-PBS targets P glycoprotein in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17811

  Product name: Recombinant human ABCB1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 624-708 aa of BC130424

  Sequence: KLVTMQTAGNEVELENAADESKSEIDALEMSSNDSRSSLIRKRSTRRSVRGSQAQDRKLSTKEALDESIPPVSFWRIMKLNLTEW

• Full Name: ATP-binding cassette, sub-family B (MDR/TAP), member 1
• Calculated Molecular Weight: 1280 aa, 142 kDa
• Observed Molecular Weight: 130-150 kDa
• GenBank Accession Number: BC130424
• Gene Symbol: P glycoprotein
• Gene ID (NCBI): 5243
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P08183
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ABCB1 (also known as P-gp/ P-glycoprotein, MDR1/multidrug-resistance 1) is a plasma membrane protein first discovered in multidrug resistant tumor cells. ABCB1 can extrude a large number of medically relevant compounds from cells and causes drug resistance. ABCB1 is expressed in a variety of human cancers as well as normal tissues including brain, and placenta. Overexpression of ABCB1 correlates with a negative prognosis in several types of cancer. For optimal WB detection, we recommend to avoid boiling the sample after lysis.