P glycoprotein Monoclonal antibody

• 

  WB analysis of HeLa using 67258-2-Ig

  unboiled HeLa cells were subjected to SDS PAGE followed by western blot with 67258-2-Ig (ABCB1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SH-SY5Y using 67258-2-Ig

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 67258-2-Ig (ABCB1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 67258-2-Ig

  unboiled HepG2 cells were subjected to SDS PAGE followed by western blot with 67258-2-Ig (ABCB1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human kidney using 67258-2-Ig

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 67258-2-Ig (ABCB1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 67258-2-Ig

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 67258-2-Ig (ABCB1 antibody) at dilution of 1:16000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of COLO 320 using 67258-2-Ig

  Immunofluorescent analysis of (4% PFA) fixed COLO 320 cells using P glycoprotein antibody (67258-2-Ig, Clone: 1G6C2 ) at dilution of 1:1000 and Multi-rAb CoraLite® Plus 594-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (Cat.NO. RGAM004 ).

P glycoprotein Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67258-2-Ig

Clone No.1G6C2

Publications(1)

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

ABCB1, 1G6C2, EC:7.6.2.2, EC:7.6.2.1, ATP-dependent translocase ABCB1

---

Tested Applications

• Positive WB detected in: unboiled HeLa cells, unboiled HepG2 cells, SH-SY5Y cells
• Positive IHC detected in: human kidney tissue, human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: COLO 320 cells

Boiling the sample after lysis is not recommended.

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

67258-2-Ig targets P glycoprotein in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17811

  Product name: Recombinant human ABCB1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 624-708 aa of BC130424

  Sequence: KLVTMQTAGNEVELENAADESKSEIDALEMSSNDSRSSLIRKRSTRRSVRGSQAQDRKLSTKEALDESIPPVSFWRIMKLNLTEW

• Full Name: ATP-binding cassette, sub-family B (MDR/TAP), member 1
• Calculated Molecular Weight: 1280 aa, 142 kDa
• Observed Molecular Weight: 130-150 kDa
• GenBank Accession Number: BC130424
• Gene Symbol: P glycoprotein
• Gene ID (NCBI): 5243
• RRID: AB_3085039
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P08183
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ABCB1 (also known as P-gp/ P-glycoprotein, MDR1/multidrug-resistance 1) is a plasma membrane protein first discovered in multidrug resistant tumor cells. ABCB1 can extrude a large number of medically relevant compounds from cells and causes drug resistance. ABCB1 is expressed in a variety of human cancers as well as normal tissues including brain, and placenta. Overexpression of ABCB1 correlates with a negative prognosis in several types of cancer. For optimal WB detection, we recommend to avoid boiling the sample after lysis.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Drug Resist Updat; YTHDF2-mediated m6A modification of ONECUT2 promotes stemness and oxaliplatin resistance in gastric cancer through transcriptionally activating TFPI; Authors - Xingdi Fan