P2RX5 Polyclonal antibody

• 

P2RX5 Polyclonal Antibody for ELISA

Cat No. 13609-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

ATP receptor, P2RX5, P2X purinoceptor 5, P2X5, P2X5R, Purinergic receptor

---

Product Information

13609-1-AP targets P2RX5 in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4499

  Product name: Recombinant human P2RX5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 52-422 aa of BC039015

  Sequence: KKGYQDVDTSLQSAVITKVKGVAFTNTSDLGQRIWDVADYVIPAQGENVFFVVTNLIVTPNQRQNVCAENEGIPDGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKEAEDFTIFIKNHIRFPKFNFSKSNVMDVKDRSFLKSCHFGPKNHYCPIFRLGSVIRWAGSDFQDIALEGGVIGINIEWNCDLDKAASECHPHYSFSRLDNKLSKSVSSGYNFRFARYYRDAAGVEFRTLMKAYGIRFDVMVNGKGAFFCDLVLIYLIKKREFYRDKKYEEVRGLEDSSQEAEDEASGLGLSEQLTSGPGLLGMPEQQELQEPPEAKRGSSSQKGNGSVCPQLLEPHRST

• Full Name: purinergic receptor P2X, ligand-gated ion channel, 5
• Calculated Molecular Weight: 422 aa, 47 kDa
• GenBank Accession Number: BC039015
• Gene Symbol: P2RX5
• Gene ID (NCBI): 5026
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q93086
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.