P2RY12 Polyclonal antibody, PBS Only

• 

  WB analysis of mouse spinal cord using 11976-1-AP (same clone as 11976-1-PBS)

  mouse spinal cord tissue were subjected to SDS PAGE followed by western blot with 11976-1-AP (P2RY12 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11976-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human adrenal gland using 11976-1-AP (same clone as 11976-1-PBS)

  human adrenal gland tissue were subjected to SDS PAGE followed by western blot with 11976-1-AP (P2RY12 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11976-1-PBS in a different storage buffer formulation.

P2RY12 Polyclonal Antibody for WB, ELISA

Cat No. 11976-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

---

Product Information

11976-1-PBS targets P2RY12 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2601

  Product name: Recombinant human P2RY12 protein

  Source: e coli.-derived, T-GST

  Tag: GST

  Domain: 1-342 aa of BC017898

  Sequence: MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM

• Full Name: purinergic receptor P2Y, G-protein coupled, 12
• Calculated Molecular Weight: 342 aa, 39 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC017898
• Gene Symbol: P2RY12
• Gene ID (NCBI): 64805
• RRID: AB_11182489
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H244
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.