P30 of ASFV Polyclonal antibody

• 

  ELISA experiment of FusionProtein using 29513-1-AP

  P30 of ASFV Antibody (29513-1-AP) tested by ELISA. P30 of ASFV(1-204aa ) were coated onto microtiter plates at 0.15 µg/well and then incubated with a dilution series of P30 of ASFV Antibody (29513-1-AP). Bound antibodies were detected with HRP conjugated anti-Rabbit IgG followed by incubation with HRP Substrate and then measuring the resulting absorbance at 450 nm.

P30 of ASFV Polyclonal Antibody for ELISA

Cat No. 29513-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

asfv

Applications

ELISA

Synonyms

Ba71V-93, CP204L, p30, Phosphoprotein p30, Phosphoprotein p32 (p32)

---

Tested Applications

• Positive ELISA detected in: FusionProtein

Recommended dilution

• Enzyme-linked Immunosorbent Assay (ELISA): ELISA : 1:256000-1:1024000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29513-1-AP targets P30 of ASFV in ELISA applications and shows reactivity with asfv samples.

• Tested Reactivity: asfv
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31446

  Product name: Recombinant asfv P30 of ASFV protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-204 aa of M96354

  Sequence: MDFILNISMKMEVIFKTDLRSSSQVVFHAGSLYNWFSVEIINSGRIVTTAIKTLLSTVKYDIVKSAHIYAGQGYTEHQAQEEWNMILHVLFEEETESSASSESIHEKNDNETNECTSSFETLFEQEPSSEEPKDSKLYMLAQKTVQHIEQYGKAPDFNKVIRAHNFIQTIHGTPLKEEEKEVVRLMVIKLLKKNKLLSHLHLMF

• Full Name: Phosphoprotein p30
• Calculated Molecular Weight: 30 kDa
• GenBank Accession Number: M96354
• Gene Symbol: P30 of ASFV
• Gene ID (NCBI): 22220322
• RRID: AB_2923595
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P34204
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.