Asfv P30 of ASFV Monoclonal antibody, PBS Only

• 

  WB analysis using 68134-1-Ig (same clone as 68134-1-PBS)

  Recombinant protein of P30 of ASFV were subjected to SDS PAGE followed by western blot with 68134-1-Ig (P30 of ASFV antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68134-1-PBS in a different storage buffer formulation.

P30 of ASFV Monoclonal Antibody for WB, ELISA

Cat No. 68134-1-PBS

Clone No.3B9E3

Host / Isotype

Mouse / IgG1

Reactivity

asfv

Applications

WB, ELISA

Synonyms

3B9E3, Ba71V-93, CP204L, p30, Phosphoprotein p30

---

Product Information

68134-1-PBS targets P30 of ASFV in WB, ELISA applications and shows reactivity with asfv samples.

• Tested Reactivity: asfv
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31446

  Product name: Recombinant asfv P30 of ASFV protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-204 aa of M96354

  Sequence: MDFILNISMKMEVIFKTDLRSSSQVVFHAGSLYNWFSVEIINSGRIVTTAIKTLLSTVKYDIVKSAHIYAGQGYTEHQAQEEWNMILHVLFEEETESSASSESIHEKNDNETNECTSSFETLFEQEPSSEEPKDSKLYMLAQKTVQHIEQYGKAPDFNKVIRAHNFIQTIHGTPLKEEEKEVVRLMVIKLLKKNKLLSHLHLMF

• Full Name: Phosphoprotein p30
• Calculated Molecular Weight: 30 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: M96354
• Gene Symbol: P30 of ASFV
• Gene ID (NCBI): 22220322
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P34204
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.