P54 of ASFV Polyclonal antibody

• 

  ELISA experiment of FusionProtein using 29511-1-AP

  P54 of ASFV Antibody (29511-1-AP) tested by ELISA. P54 of ASFV(1-65aa ) were coated onto microtiter plates at 0.15 µg/well and then incubated with a dilution series of P54 of ASFV Antibody (29511-1-AP). Bound antibodies were detected with HRP conjugated anti-Rabbit IgG followed by incubation with HRP Substrate and then measuring the resulting absorbance at 450 nm.

P54 of ASFV Polyclonal Antibody for ELISA

Cat No. 29511-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

asfv

Applications

ELISA

Synonyms

Ba71V-126, E183L, Inner membrane protein p54, pE183L

---

Tested Applications

• Positive ELISA detected in: FusionProtein

Recommended dilution

• Enzyme-linked Immunosorbent Assay (ELISA): ELISA : 1:556544-1:2226176

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29511-1-AP targets P54 of ASFV in ELISA applications and shows reactivity with asfv samples.

• Tested Reactivity: asfv
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31444

  Product name: Recombinant asfv P54 of ASFV protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-65 aa of AAA65354

  Sequence: VLIYLFSSRKKKAAAAIEEEDIQFINPYQDQQWAEVTPQPGTSKPAGATTASAGKPVTGRPATNR

• Full Name: Envelope protein p54
• Calculated Molecular Weight: 20 kDa
• GenBank Accession Number: AAA65354
• Gene Symbol: P54 of ASFV
• Gene ID (NCBI): 22220355
• RRID: AB_2923593
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q65194
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.