P72 of ASFV Polyclonal antibody

• 

  ELISA experiment of FusionProtein using 29512-1-AP

  P72 of ASFV Antibody (29512-1-AP) tested by ELISA. P72 of ASFV(1-117aa) were coated onto microtiter plates at 0.15 µg/well and then incubated with a dilution series of P72 of ASFV Antibody (29512-1-AP). Bound antibodies were detected with HRP conjugated anti-Rabbit IgG followed by incubation with HRP Substrate and then measuring the resulting absorbance at 450 nm.

P72 of ASFV Polyclonal Antibody for ELISA

Cat No. 29512-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

asfv

Applications

ELISA

Synonyms

B646L, Ba71V-081, Hexon protein p72, Major capsid protein (MCP), p72

---

Tested Applications

• Positive ELISA detected in: FusionProtein

Recommended dilution

• Enzyme-linked Immunosorbent Assay (ELISA): ELISA : 1:128000-1:512000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29512-1-AP targets P72 of ASFV in ELISA applications and shows reactivity with asfv samples.

• Tested Reactivity: asfv
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31445

  Product name: Recombinant asfv P72 of ASFV protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-117 aa of M34142

  Sequence: DEYSSDVTTLVRKFCIPGDKMTGYKHLVGQEVSVEGTSGPLLCNIHDLHKPHQSKPILTDENDTQRTCSHTNPKFLSQHFPENSHNIQTAGKQDITPITDATYLDIRRNVHYSCNGP

• Full Name: Major capsid protein
• Calculated Molecular Weight: 72 kDa
• GenBank Accession Number: M34142
• Gene Symbol: P72 of ASFV
• Gene ID (NCBI): 22220311
• RRID: AB_2923594
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P22776
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.