Tested Applications
| Positive ELISA detected in | FusionProtein |
Recommended dilution
| Application | Dilution |
|---|---|
| Enzyme-linked Immunosorbent Assay (ELISA) | ELISA : 1:128000-1:512000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
29512-1-AP targets P72 of ASFV in ELISA applications and shows reactivity with asfv samples.
| Tested Reactivity | asfv |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag31445 Product name: Recombinant asfv P72 of ASFV protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-117 aa of M34142 Sequence: DEYSSDVTTLVRKFCIPGDKMTGYKHLVGQEVSVEGTSGPLLCNIHDLHKPHQSKPILTDENDTQRTCSHTNPKFLSQHFPENSHNIQTAGKQDITPITDATYLDIRRNVHYSCNGP Predict reactive species |
| Full Name | Major capsid protein |
| Calculated Molecular Weight | 72 kDa |
| GenBank Accession Number | M34142 |
| Gene Symbol | P72 of ASFV |
| Gene ID (NCBI) | 22220311 |
| RRID | AB_2923594 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P22776 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |

