PAK7 Polyclonal antibody

• 

  WB analysis using 27847-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27847-1-AP (PAK7 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 27847-1-AP

  IP result of anti-PAK7 (IP:27847-1-AP, 4ug; Detection:27847-1-AP 1:3000) with mouse brain tissue lysate 1280 ug.

PAK7 Polyclonal Antibody for WB, IP, ELISA

Cat No. 27847-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse , rat

Applications

WB, IP, ELISA

Synonyms

KIAA1264, p21 activated kinase 5, p21 activated kinase 7, PAK 5, PAK 7, PAK5, PAK7

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IP detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27847-1-AP targets PAK7 in WB, IP, ELISA applications and shows reactivity with Human, mouse , rat samples.

• Tested Reactivity: Human, mouse , rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27283

  Product name: Recombinant human PAK7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-200 aa of BC024179

  Sequence: MFGKKKKKIEISGPSNFEHRVHTGFDPQEQKFTGLPQQWHSLLADTANRPKPMVDPSCITPIQLAPMKTIVRGNKPCKETSINGLLEDFDNISVTRSNSLRKESPPTPDQGASSHGPGHAEENGFITFSQYSSESDTTADYTTEKYREKSLYGDDLDPYYRGSHAAKQNGHVMKMKHGEAYYSEVKPLKSDFARFSADYH

• Full Name: p21 protein (Cdc42/Rac)-activated kinase 7
• Calculated Molecular Weight: 719 aa, 81 kDa
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: BC024179
• Gene Symbol: PAK7
• Gene ID (NCBI): 57144
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P286
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

p21-activated kinase 7 (PAK7), also known as PAK5, is a member of the p21-activated kinase family (Paks). PAK7 is mainly expressed in the brain and testis and has a molecular mass of 81 kDa. It plays an important role in tumorigenesis, invasion and metastasis (PMID: 19165420).