PAK7 Monoclonal antibody, PBS Only

• 

  WB analysis of mouse brain using 66961-1-Ig (same clone as 66961-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 66961-1-Ig (PAK7 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66961-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig brain using 66961-1-Ig (same clone as 66961-1-PBS)

  pig brain tissue were subjected to SDS PAGE followed by western blot with 66961-1-Ig (PAK7 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66961-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 66961-1-Ig (same clone as 66961-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 66961-1-Ig (PAK7 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66961-1-PBS in a different storage buffer formulation.

• 

  IF Staining of Neuro-2a using 66961-1-Ig (same clone as 66961-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Neuro-2a cells using PAK7 antibody (66961-1-Ig, Clone: 1H3B6 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66961-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U-251 using 66961-1-Ig (same clone as 66961-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed U-251 cells using PAK7 antibody (66961-1-Ig, Clone: 1H3B6 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66961-1-PBS in a different storage buffer formulation.

PAK7 Monoclonal Antibody for WB, IF, Indirect ELISA

Cat No. 66961-1-PBS

Clone No.1H3B6

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat, Pig

Applications

WB, IF, Indirect ELISA

Synonyms

KIAA1264, p21 activated kinase 5, p21 activated kinase 7, PAK 5, PAK 7, PAK5, PAK7

---

Product Information

66961-1-PBS targets PAK7 in WB, IF, Indirect ELISA applications and shows reactivity with Human, Mouse, Rat, Pig samples.

• Tested Reactivity: Human, Mouse, Rat, Pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27299

  Product name: Recombinant human PAK7 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-200 aa of BC024179

  Sequence: MFGKKKKKIEISGPSNFEHRVHTGFDPQEQKFTGLPQQWHSLLADTANRPKPMVDPSCITPIQLAPMKTIVRGNKPCKETSINGLLEDFDNISVTRSNSLRKESPPTPDQGASSHGPGHAEENGFITFSQYSSESDTTADYTTEKYREKSLYGDDLDPYYRGSHAAKQNGHVMKMKHGEAYYSEVKPLKSDFARFSADYH

• Full Name: p21 protein (Cdc42/Rac)-activated kinase 7
• Calculated Molecular Weight: 719 aa, 81 kDa
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: BC024179
• Gene Symbol: PAK7
• Gene ID (NCBI): 57144
• RRID: AB_2882284
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9P286
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PAK7(p21-activated kinase 7) is also named as KIAA1264, PAK5 and belongs to the STE Ser/Thr protein kinase family. It plays a role in a variety of different signaling pathways including cytoskeleton regulation, cell migration, proliferation or cell survival.