PALM Polyclonal antibody, PBS Only

• 

  WB analysis using 31637-1-AP (same clone as 31637-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31637-1-AP (PALM antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31637-1-PBS in a different storage buffer formulation.

PALM Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31637-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

31637-1-PBS targets PALM in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36100

  Product name: Recombinant human PALM protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-387 aa of BC032449

  Sequence: MEVLAAETTSQQERLQAIAEKRKRQAEIENKRRQLEDERRQLQHLKSKALRERWLLEGTPSSASEGDEDLRRQMQDDEQKTRLLEDSVSRLEKEIEVLERGDSAPATAKENAAAPSPVRAPAPSPAKEERKTEVVMNSQQTPVGTPKDKRVSNTPLRTVDGSPMMKAAMYSVEITVEKDKVTGETRVLSSTTLLPRQPLPLGIKVYEDETKVVHAVDGTAENGIHPLSSSEVDELIHKADEVTLSEAGSTAGAAETRGAVEGAARTTPSRREITGVQAQPGEATSGPPGIQPGQEPPVTMIFMGYQNVEDEAETKKVLGLQDTITAELVVIEDAAEPKEPAPPNGSAAEPPTEAASREENQAGPEATTSDPQDLDMKKHRCKCCSIM

• Full Name: paralemmin
• Calculated Molecular Weight: 42 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC032449
• Gene Symbol: PALM
• Gene ID (NCBI): 5064
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O75781
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.