PAPPA Monoclonal antibody

• 

  WB analysis of human placenta using 66962-1-Ig

  human placenta tissue were subjected to SDS PAGE followed by western blot with 66962-1-Ig (PAPPA antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 66962-1-Ig

  WB result of PAPPA antibody (66962-1-Ig; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PAPPA transfected MCF-7 cells.

• 

  IHC staining of human placenta using 66962-1-Ig

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 66962-1-Ig (PAPPA antibody) at dilution of 1:1000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 66962-1-Ig

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 66962-1-Ig (PAPPA antibody) at dilution of 1:1000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

PAPPA Monoclonal Antibody for WB, IHC, ELISA

Cat No. 66962-1-Ig

Clone No.1G5A7

Publications(1)

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

1G5A7, ASBABP2, DIPLA1, EC:3.4.24.79, IGFBP 4ase

---

Tested Applications

• Positive WB detected in: human placenta tissue, MCF-7 cells
• Positive IHC detected in: human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:4000-1:10000
• Immunohistochemistry (IHC): IHC : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

66962-1-Ig targets PAPPA in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11863

  Product name: Recombinant human PAPPA protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1279-1627 aa of BC078657

  Sequence: ACEPVDCSIPDHHQVYAASFSCPEGTTFGSQCSFQCRHPAQLKGNNSLLTCMEDGLWSFPEALCELMCLAPPPVPNADLQTARCRENKHKVGSFCKYKCKPGYHVPGSSRKSKKRAFKTQCTQDGSWQEGACVPVTCDPPPPKFHGLYQCTNGFQFNSECRIKCEDSDASQGLGSNVIHCRKDGTWNGSFHVCQEMQGQCSVPNELNSNLKLQCPDGYAIGSECATSCLDHNSESIILPMNVTVRDIPHWLNPTRVERVVCTAGLKWYPHPALIHCVKGCEPFMGDNYCDAINNRAFCNYDGGDCCTSTVKTKKVTPFPMSCDLQGDCACRDPQAQEHSRKDLQGYSHG

• Full Name: pregnancy-associated plasma protein A, pappalysin 1
• Calculated Molecular Weight: 1627 aa, 181 kDa
• Observed Molecular Weight: 180-220 kDa
• GenBank Accession Number: BC078657
• Gene Symbol: PAPPA
• Gene ID (NCBI): 5069
• RRID: AB_2882285
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q13219
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Pregnancy-associated plasma protein A (PAPPA) is a metalloproteinase secreted by human placenta, and it can interact with IGF-binding proteins (IGFBPs) to regulate the proteolysis and the bioavailability of insulin-like growth factor (IGF). Circulating PAPPA represents a consolidated biomarker in combined first-trimester screening tests, allowing an early prenatal diagnosis of chromosomal abnormalities, preeclampsia, and intrauterine growth restriction risk. PAPPA is highly expressed in placenta and pregnancy serum (PMID: 34974815, 34974815).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Oncol; Cancer-associated fibroblasts educate normal fibroblasts to facilitate cancer cell spreading and T cell suppression.; Authors - Go Itoh