Product Information
66064-2-Ig targets PAX4 in ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17007 Product name: Recombinant human PAX4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 219-344 aa of BC074761 Sequence: RQEKLKWEMQLPGASQGLTVPRVAPGIISAQQSPGSVPTAALPALEPLGPSCYQLCWATAPERCLSDTPPKACLKPCWGHLPPQPNSLDSGLLCLPCPSSHCPLASLSGSQALLWPGCPLLYGLE Predict reactive species |
| Full Name | paired box 4 |
| Calculated Molecular Weight | 343 aa, 37 kDa |
| GenBank Accession Number | BC074761 |
| Gene Symbol | PAX4 |
| Gene ID (NCBI) | 5078 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | O43316 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PAX4, a paired-box transcription factor, is a key regulator of pancreatic islet cell growth and differentiation. Differentiation of endoderm-derived endocrine pancreas is mediated through PAX4 and PAX6. PAX4 may act as a PAX6 repressor due to the competition for binding sites and lower transactivation potential of Pax-4. PAX4 has the potential to function as a tumor suppressor in human melanoma.
