Published Applications
| IF | See 1 publications below |
Product Information
21384-1-AP targets PAX8 in IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16019 Product name: Recombinant human PAX8 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 135-212 aa of BC001060 Sequence: KVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDS Predict reactive species |
| Full Name | paired box 8 |
| Calculated Molecular Weight | 450 aa, 48 kDa |
| GenBank Accession Number | BC001060 |
| Gene Symbol | PAX8 |
| Gene ID (NCBI) | 7849 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q06710 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PAX8 is a member of the paired box (PAX) family of transcription factors, typically containing a paired box domain and a paired-type homeodomain. The specific function of the PAX8 is unknown but it may involve kidney cell differentiation, thyroid development, or thyroid dysgenesis. Several other splice variants have been proposed but the full nature of these products has not been described. Pax8 is also a marker of otic progenitor cells. PAX8 is a useful marker in distinguishing ovarian carcinomas from mammary carcinomas. PAX8 can be used in a differential diagnosis between primary and secondary ovarian carcinomas in patients with a previous history of breast cancer. Mutation of PAX8 will cause congenital hypothyroidism non-goitrous type 2 (CHNG2). This antibody is specific to Pax8.
Publications
| Species | Application | Title |
|---|---|---|
Sci Rep Directed Differentiation of Human Induced Pluripotent Stem Cells into Fallopian Tube Epithelium. | ||
Cell Rep Human iPSC-derived fallopian tube organoids with BRCA1 mutation recapitulate early-stage carcinogenesis. |
