PCOTH Polyclonal antibody

• 

  IHC staining of mouse testis using 24564-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 24564-1-AP (PCOTH antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 24564-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 24564-1-AP (PCOTH antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 24564-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 24564-1-AP (PCOTH antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 24564-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 24564-1-AP (PCOTH antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of PC-3 using 24564-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed PC-3 cells using PCOTH antibody (24564-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

PCOTH Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 24564-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, ELISA

Synonyms

PCOTH, prostate collagen triple helix, Protein PCOTH

---

Tested Applications

• Positive IHC detected in: mouse testis tissue, human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: PC-3 cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24564-1-AP targets PCOTH in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20092

  Product name: Recombinant human PCOTH protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 8-107 aa of BC142999

  Sequence: GTSEEGNLLSTVSPTVKALFGKTRVSPIFPFSPRSPFQPLIPRTPGSPWGPVGPASPLGPGFPIGPMGPGKPVGPKGPMLPLGPSGPVGPTSPLFPFCP

• Full Name: prostate collagen triple helix
• Calculated Molecular Weight: 107 aa, 11 kDa
• GenBank Accession Number: BC142999
• Gene Symbol: PCOTH
• Gene ID (NCBI): 542767
• RRID: AB_2918084
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q58A44
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PCOTH may be involved in growth and survival of prostate cancer cells through the TAF-Ibeta pathway.