Tested Applications
| Positive IF/ICC detected in | PC-3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-24564 targets PCOTH in IF/ICC applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20092 Product name: Recombinant human PCOTH protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 8-107 aa of BC142999 Sequence: GTSEEGNLLSTVSPTVKALFGKTRVSPIFPFSPRSPFQPLIPRTPGSPWGPVGPASPLGPGFPIGPMGPGKPVGPKGPMLPLGPSGPVGPTSPLFPFCP Predict reactive species |
| Full Name | prostate collagen triple helix |
| Calculated Molecular Weight | 107 aa, 11 kDa |
| GenBank Accession Number | BC142999 |
| Gene Symbol | PCOTH |
| Gene ID (NCBI) | 542767 |
| RRID | AB_3672770 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q58A44 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
PCOTH may be involved in growth and survival of prostate cancer cells through the TAF-Ibeta pathway.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL Plus 488 PCOTH antibody CL488-24564 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

