CoraLite® Plus 488-conjugated PCOTH Polyclonal antibody

• 

  IF Staining of PC-3 using CL488-24564

  Immunofluorescent analysis of (-20°C Ethanol) fixed PC-3 cells using CoraLite® Plus 488 PCOTH antibody (CL488-24564) at dilution of 1:200.

PCOTH Polyclonal Antibody for IF/ICC

Cat No. CL488-24564

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

Synonyms

PCOTH, prostate collagen triple helix, Protein PCOTH

---

Tested Applications

• Positive IF/ICC detected in: PC-3 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-24564 targets PCOTH in IF/ICC applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20092

  Product name: Recombinant human PCOTH protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 8-107 aa of BC142999

  Sequence: GTSEEGNLLSTVSPTVKALFGKTRVSPIFPFSPRSPFQPLIPRTPGSPWGPVGPASPLGPGFPIGPMGPGKPVGPKGPMLPLGPSGPVGPTSPLFPFCP

• Full Name: prostate collagen triple helix
• Calculated Molecular Weight: 107 aa, 11 kDa
• GenBank Accession Number: BC142999
• Gene Symbol: PCOTH
• Gene ID (NCBI): 542767
• RRID: AB_3672770
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q58A44
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

PCOTH may be involved in growth and survival of prostate cancer cells through the TAF-Ibeta pathway.