Tested Applications
| Positive WB detected in | LNCaP cells, mouse cerebellum tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
30485-1-AP targets PCYOX1L in WB, ELISA applications and shows reactivity with Human, mouse samples.
| Tested Reactivity | Human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag33077 Product name: Recombinant human PCYOX1L protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 305-418 aa of BC000014 Sequence: ASFRRKQPQEAAVWRVQSPKPLFRTQLKTLFRSYYSVQTAEWQAHPLYGSRPTLPRFALHDQLFYLNALEWAASSVEVMAVAAKNVALLAYNRWYQDLDKIDQKDLMHKVKTEL Predict reactive species |
| Full Name | prenylcysteine oxidase 1 like |
| Calculated Molecular Weight | 494 aa, 55 kDa |
| Observed Molecular Weight | 55-57 kDa |
| GenBank Accession Number | BC000014 |
| Gene Symbol | PCYOX1L |
| Gene ID (NCBI) | 78991 |
| RRID | AB_3086333 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8NBM8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for PCYOX1L antibody 30485-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



