PD-L1/CD274 Recombinant monoclonal antibody, PBS Only

PD-L1/CD274 Uni-rAb® Recombinant Antibody for IHC, IF-P, Indirect ELISA
Cat No. 82719-13-PBS
Clone No.3G4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF-P, Indirect ELISA

CD274, PD-L1, 3G4, B7 H1, B7-H1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82719-13-PBS targets PD-L1/CD274 in IHC, IF-P, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag12432

Product name: Recombinant human PD-L1/CD274 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 25-241 aa of BC074984

Sequence: KDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTHL

Predict reactive species
Full Name CD274 molecule
Calculated Molecular Weight 290 aa, 33 kDa
GenBank Accession NumberBC074984
Gene Symbol PD-L1
Gene ID (NCBI) 29126
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NZQ7
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Programmed cell death ligand 1 (PD-L1, CD274, or B7-H1), is the first member of B7 family to be discovered. B7 family molecules are type I transmembrane proteins belonging to the immunoglobulin superfamily. In concert with their CD28 family receptors, the B7s are key regulators of the adaptive immune response. PD-L1 is suggested as a negative regulator of T and B cell, and plays important role in mediating tolerance of lymphocytes to self-antigens. It is also involved in the costimulatory signal, essential for T-cell proliferation and production of IL10 and IFNG, in an IL2-dependent and a PD-1-independent manner. PD-L1 is a 290 aa transmembrane protein with a calculated molecular weight of 33 kDa, it is predicted to be 27-30 kDa after signal peptide cleavage (PMID: 25609200; 17076679). The apparent molecular weight has also been reported as 45-70 kDa, major glycosylated form of 45-50 kDa and multiple post-translational modifications form of 65-70 kDa (PMID: 18760278; 16493058).

Loading...
||
New chat Able
正在加载,请稍候...