PDCD5 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PDCD5 Polyclonal antibody (12456-1-AP)

• Featured Product
• KD/KO Validated

PDCD5 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 12456-1-AP Copied!

Publications (17)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF, IP, ELISA

Synonyms

PDCD 5, programmed cell death 5, Programmed cell death protein 5, TF-1 cell apoptosis-related protein 19

• 

  WB analysis of human heart using 12456-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 12456-1-AP (PDCD5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of PC-3 using 12456-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 12456-1-AP (PDCD5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 12456-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 12456-1-AP (PDCD5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A549 using 12456-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 12456-1-AP (PDCD5 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of A549 using 12456-1-AP

  IP result of anti-PDCD5 (IP:12456-1-AP, 4ug; Detection:12456-1-AP 1:800) with A549 cells lysate 800 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human endometrial cancer using 12456-1-AP

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer tissue slide using 12456-1-AP (PDCD5 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human endometrial cancer using 12456-1-AP

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer tissue slide using 12456-1-AP (PDCD5 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin cancer using 12456-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 12456-1-AP (PDCD5 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin cancer using 12456-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 12456-1-AP (PDCD5 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PDCD5 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human heart tissue, PC-3 cells, human brain tissue, A549 cells
• Positive IP detected in: A549 cells
• Positive IHC detected in: human endometrial cancer tissue, human skin cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12456-1-AP targets PDCD5 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3122

  Product name: Recombinant human PDCD5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-125 aa of BC015519

  Sequence: MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDY

• Full Name: programmed cell death 5
• Calculated Molecular Weight: 125 aa, 14 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: BC015519
• Gene Symbol: PDCD5
• Gene ID (NCBI): 9141
• RRID: AB_2162450
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14737
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PDCD5, also called TFAR19 (TF1 cell apoptosis-related gene 19), was first identified as a gene up-regulated in TF-1 cells under-going apoptosis (PMID: 9920759). PDCD5 can promote pro-grammed cell death in different cell types in response to various stimuli and also enhance TAJ/TROY-induced paraptosis-like cell death (PMID: 15020679). During apoptosis, PDCD5 is rapidly upregulated and translocates from the cytoplasm to nucleus (PMID: 11741587). PDCD5 is a positive regulator of Tip60 and also has a potential ability to interact with p53 (PMID: 22914926, PMID: 19308289). Recent studies have also revealed that PDCD5 may be a suppressor gene and expressed at lower levels in many cancers, including hepatocellular carcinoma, breast cancer, gastric cancer, cervical cancer, lung cancer, astrocytic gliomas, and in leukemia.

Publications

What published studies show

The PDCD5 antibody (Cat# 12456-1-AP) has 17 citations across journals including Nature, Nature Communications, Science Advances, Cancer Letters, Scientific Reports, Journal of Cellular Physiology, and others. Research fields span apoptosis, genotoxic stress response, protein chaperone function (TRiC), pulmonary fibrosis, and multiple cancers (lung, nasopharyngeal, colon, breast), as well as diabetic retinopathy, brain ischemia, autophagy, and viral infection.

Automatically generated from the 17 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nature; In situ analysis reveals the TRiC duty cycle and PDCD5 as an open-state cofactor; Authors - Huaipeng Xing ; KD Validated
	WB	Nat Commun; Programmed cell death 5 mediates HDAC3 decay to promote genotoxic stress response.; Authors - Hyo-Kyoung Choi ; KD Validated
	WB,IHC	Nat Commun; Club cell-specific role of programmed cell death 5 in pulmonary fibrosis.; Authors - Soo-Yeon Park
human	WB	J Nanobiotechnology; Multifunctional photodynamic/photothermal nano-agents for the treatment of oral leukoplakia.; Authors - Lin Lin
		Sci Adv; TRiC-assisted folding of class I HDAC family proteins regulated by distinct co-chaperone and cofactor networks.; Authors - Zuyang Li
mouse,human	WB,IF	Cancer Lett; DNAJB1 destabilizes PDCD5 to suppress p53-mediated apoptosis.; Authors - Xiandan Cui