Tested Applications
| Positive WB detected in | HeLa cells, mouse brain tissue, rat brain tissue |
| Positive IHC detected in | mouse brain tissue, rat brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
31730-1-AP targets PDE4B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag35552 Product name: Recombinant human PDE4B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 651-736 aa of BC105040 Sequence: WYQSMIPQSPSPPLDEQNRDCQGLMEKFQFELTLDEEDSEGPEKEGEGHSYFSSTKTLCVIDPENRDSLGETDIDIATEDKSPVDT Predict reactive species |
| Full Name | phosphodiesterase 4B, cAMP-specific (phosphodiesterase E4 dunce homolog, Drosophila) |
| Calculated Molecular Weight | 736 aa, 83 kDa |
| Observed Molecular Weight | 83 kDa |
| GenBank Accession Number | BC105040 |
| Gene Symbol | PDE4B |
| Gene ID (NCBI) | 5142 |
| RRID | AB_3670101 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q07343 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PDE4B, also known as DPDE4, is a member of the PDE family of type IV cAMP-specific cyclic nucleotides. PDE4B regulates the cellular concentration of cyclic nucleotides and thus plays a role in signal transduction of inflammatory factors. Among all subtypes of PDE4, PDE4B is closely associated with cancer and has a major contribution to the role in hematological malignancies. PDE4B is distributed in multiple tissues, especially myeloid cells (PMID: 35899614, PMID: 36278172).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for PDE4B antibody 31730-1-AP | Download protocol |
| WB protocol for PDE4B antibody 31730-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |









