PDE8B Polyclonal antibody, PBS Only

• 

  WB analysis using 30708-1-AP (same clone as 30708-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30708-1-AP (PDE8B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30708-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 30708-1-AP (same clone as 30708-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 30708-1-AP (PDE8B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30708-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 30708-1-AP (same clone as 30708-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 30708-1-AP (PDE8B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30708-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse testis using 30708-1-AP (same clone as 30708-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse testis tissue using PDE8B antibody (30708-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 30708-1-PBS in a different storage buffer formulation.

PDE8B Polyclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 30708-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

PPNAD3, phosphodiesterase 8B, HsPDE8B

---

Product Information

30708-1-PBS targets PDE8B in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33477

  Product name: Recombinant human PDE8B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 374-440 aa of NM_003719

  Sequence: FVSLKKLCCTTDNNKQIHKIHRDSGDNSQTEPHSFRYKNRRKESIDVKSISSRGSDAPSLQNRRYPS

• Full Name: phosphodiesterase 8B
• Calculated Molecular Weight: 99kd
• Observed Molecular Weight: 68-98 kDa
• GenBank Accession Number: NM_003719
• Gene Symbol: PDE8B
• Gene ID (NCBI): 8622
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95263
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Human phosphodiesterase (PDE) type 8B (PDE8B) is located at 5q14.1 and is known as the PDE with the highest affinity to cAMP.