PDPK1 Polyclonal antibody

• 

  WB analysis of MCF-7 using 17086-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 17086-1-AP (PDPK1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of LNCaP using 17086-1-AP

  LNCaP cells were subjected to SDS PAGE followed by western blot with 17086-1-AP (PDPK1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 17086-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 17086-1-AP (PDPK1 antibody) at dilution of 1:100 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 17086-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 17086-1-AP (PDPK1 antibody) at dilution of 1:100 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

PDPK1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 17086-1-AP

Publications(14)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

hPDK1, PDK1, PDPK1, PRO0461

---

Tested Applications

• Positive WB detected in: MCF-7 cells, LNCaP cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 13 publications below
• IHC: See 2 publications below
• IF: See 1 publications below

Product Information

17086-1-AP targets PDPK1 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9213

  Product name: Recombinant human PDPK1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 198-556 aa of BC012103

  Sequence: GKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLTAYLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSASDTGLPQRSGSNIEQYIHDLDSNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ

• Full Name: 3-phosphoinositide dependent protein kinase-1
• Calculated Molecular Weight: 556 aa, 63 kDa
• Observed Molecular Weight: 60-63 kDa
• GenBank Accession Number: BC012103
• Gene Symbol: PDPK1
• Gene ID (NCBI): 5170
• RRID: AB_2161289
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15530
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

3-Phosphoinositide dependent protein kinase-1 (PDK1 or PDPK1) is a serine-threonine kinase belonging to AGC kinase family. PDK1 plays a critical role in establishing ACD (Asymmetric cell division) in the epithelium (PMID: 27184845). The kinase activity of PDK1 depends on phosphatidyl inositol 3-kinase (PI3K), a key intermediate in signaling pathways including those from growth factor receptors and adhesion molecules. Substrates of PDK1, including AKT and the protein kinase C (PKC) isozymes, regulate a number of essential cell functions (PMID: 20027184). PDPK1 has 5 isoforms produced by alternative splicing of 48~63 kDa and is detected as 60-63 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Mol Cell; A Non-canonical PDK1-RSK Signal Diminishes Pro-caspase-8-Mediated Necroptosis Blockade.; Authors - Zhang-Hua Yang ; KO Validated
human	WB	Cell Mol Life Sci; Phosphocholine inhibits proliferation and reduces stemness of endometrial cancer cells by downregulating mTOR-c-Myc signaling; Authors - Kunxiang Gong
human	WB	PLoS Biol; Loss of hepatic aldolase B activates Akt and promotes hepatocellular carcinogenesis by destabilizing the Aldob/Akt/PP2A protein complex.; Authors - Xuxiao He
human	WB	Free Radic Biol Med; Redox sensor NPGPx restrains ZAP70 activity and modulates T cell homeostasis.; Authors - Fang-Yi Su
human	IHC	Front Immunol; Identification of senescence-related subtypes, establishment of a prognosis model, and characterization of a tumor microenvironment infiltration in breast cancer; Authors - Yanling Zhou ; KD Validated
mouse	WB	J Innate Immun; Mannan-Binding Lectin Reduces Epithelial-Mesenchymal Transition in Pulmonary Fibrosis via Inactivating the Store-Operated Calcium Entry Machinery.; Authors - Yunzhi Liu