Tested Applications
| Positive WB detected in | HEK-293 cells, Jurkat cells |
| Positive IHC detected in | mouse lung tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
30191-1-AP targets PDZD2 in WB, IHC, ELISA applications and shows reactivity with Human, mouse samples.
| Tested Reactivity | Human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag32900 Product name: Recombinant human PDZD2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 2519-2641 aa of NM_178140 Sequence: RRSPGPPAGGVSCPEKGGNRACPGGSGPKTSAAETPSSASDTGEAAQDLPFRRSWSVNLDQLLVSAGDQQRLQSVLSSVGSKSTILTLIQEAKAQSENEEDVCFIVLNRKEGSGLGFSVAGGT Predict reactive species |
| Full Name | PDZ domain containing 2 |
| Calculated Molecular Weight | 302 kDa |
| Observed Molecular Weight | 37 kDa |
| GenBank Accession Number | NM_178140 |
| Gene Symbol | PDZD2 |
| Gene ID (NCBI) | 23037 |
| RRID | AB_3086258 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O15018 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PDZD2, PDZ-domain containing-2, also named as AIPC, KIAA0300 and PDZK3, is associated with the early promotion of prostate tumoregenesis. The antibody recognizes near the N-term of PDZD2. PDZD2 is a novel factor that affects the growth and differentiation of human fetal pancreatic progenitor cells. The secreted form sPDZD2 can be detected 37 kDa (PMID: 18037333).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for PDZD2 antibody 30191-1-AP | Download protocol |
| WB protocol for PDZD2 antibody 30191-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





