Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, mouse testis tissue, SKOV-3 cells, mouse kidney tissue, rat kidney tissue |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human ovary cancer tissue, rat stomach tissue, human liver tissue, mouse pancreas tissue, rat ovary tissue, human placenta tissue, mouse ovary tissue, mouse stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10582-1-AP targets PELO in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0873 Product name: Recombinant human PELO protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 42-384 aa of BC005889 Sequence: STIRKVQTESSTGSVGSNRVRTTLTLCVEAIDFDSQACQLRVKGTNIQENEYVKMGAYHTIELEPNRQFTLAKKQWDSVVLERIEQACDPAWSADVAAVVMQEGLAHICLVTPSMTLTRAKVEVNIPRKRKGNCSQHDRALERFYEQVVQAIQRHIHFDVVKCILVASPGFVREQFCDYMFQQAVKTDNKLLLENRSKFLQVHASSGHKYSLKEALCDPTVASRLSDTKAAGEVKALDDFYKMLQHEPDRAFYGLKQVEKANEAMAIDTLLISDELFRHQDVATRSRYVRLVDSVKENAGTVRIFSSLHVSGEQLSQLTGVAAILRFPVPELSDQEGDSSSEE Predict reactive species |
| Full Name | pelota homolog (Drosophila) |
| Calculated Molecular Weight | 43 kDa |
| Observed Molecular Weight | 43-45 kDa |
| GenBank Accession Number | BC005889 |
| Gene Symbol | PELO |
| Gene ID (NCBI) | 53918 |
| RRID | AB_2236833 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BRX2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The Pelo gene was originally identified in a mutagenesis screen for spermatogenesis-specific genes of Drosophila melanogaster. The PELO is required for the meiotic division during the G2/M transition, and functions in recognizing stalled ribosomes and triggering endonucleolytic cleavage of the mRNA, a mechanism to release non-functional ribosomes and degrade damaged mRNAs [PMID:12556505]. It may participate in the machinery of protein synthesis or in the regulation of mRNA translation [PMID:9584085].
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PELO antibody 10582-1-AP | Download protocol |
| IHC protocol for PELO antibody 10582-1-AP | Download protocol |
| IP protocol for PELO antibody 10582-1-AP | Download protocol |
| WB protocol for PELO antibody 10582-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The PELO Polyclonal antibody (Catalog No. 10582-1-AP) has 19 citations. These appear in journals including Nature, Cell, Immunity, Nature Communications, Molecular Cell, Nucleic Acids Research, EMBO Journal, Cell Reports, FEBS Journal, PLoS Genetics, STAR Protocols, eLife, and bioRxiv. The research fields span ribosome-associated quality control, translation regulation, mRNA surveillance, and stalled-ribosome rescue, with studies on cancer, retinal dystrophy, neurodevelopment, and the unfolded protein response. Most citations used the antibody for Western blot, with some for IP and IF.
| Species | Application | Title |
|---|---|---|
Cell Global genetic interaction network of a human cell maps conserved principles and informs functional interpretation of gene co-essentiality profiles.
| ||
Immunity Ribosome-rescuer PELO catalyzes the oligomeric assembly of NOD-like receptor family proteins via activating their ATPase enzymatic activity | ||
Nat Commun Single-molecule imaging reveals distinct elongation and frameshifting dynamics between frames of expanded RNA repeats in C9ORF72-ALS/FTD | ||
Nat Commun Stalled translation by mitochondrial stress upregulates a CNOT4-ZNF598 ribosomal quality control pathway important for tissue homeostasis | ||
Mol Cell Unresolved stalled ribosome complexes restrict cell-cycle progression after genotoxic stress. |
Reviews
What customers say
The antibody performed well for Western Blot using chemiluminescence, producing reliable results in HeLa, MT4, and HEK293T cells at a 1:1000 dilution. However, it did not work with fluorescent secondary antibodies. Overall, the reviewer rated it 4 out of 5, describing it as a good antibody for chemiluminescent WB applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Daniel (Verified Customer) (10-26-2022) | This is a good antibody. It works well in western blot using chemiluminescence but not fluorescent secondary antibodies.
 |
