• Featured Product
  • KD/KO Validated

PEX5 Polyclonal antibody

PEX5 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 12545-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA

Peroxin 5, Peroxin-5, Peroxisomal C-terminal targeting signal import receptor, Peroxisome receptor 1, PEX

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, HEK-293 cells, human brain tissue, human kidney tissue, L02 cells, mouse kidney tissue, mouse brain tissue, rat brain tissue
Positive IP detected inRaji cells, mouse kidney tissue
Positive IHC detected inhuman kidney tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:100-1:400
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12545-1-AP targets PEX5 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3268

Product name: Recombinant human PEX5 protein

Source: e coli.-derived, T-HIS

Tag: 6*His

Domain: 340-639 aa of BC010621

Sequence: EGDLPNAVLLFEAAVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTNESLQRQACETLRDWLRYTPAYAHLVTPAEEGAGGAGLGPSKRILGSLLSDSLFLEVKELFLAAVRLDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFGLPQ

Predict reactive species
Full Name peroxisomal biogenesis factor 5
Calculated Molecular Weight 631 aa, 70 kDa
Observed Molecular Weight 68-80 kDa
GenBank Accession NumberBC010621
Gene Symbol PEX5
Gene ID (NCBI) 5830
RRIDAB_2268102
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP50542
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The peroxisomal targeting signal type1 (PTS1) receptor, PEX5, is one member of peroxins (PEXs) which are proteins required for peroxisome assembly. PEX5 and PEX7 function as receptors that recognize PTS1- and PTS2- containing proteins, respectively, and PEX5 binds PTS1 through its C-terminal 40-kDa tetratricopeptide repeat domain. It is a predominantly cytoplasmic, partly peroxisomal protein that appears to shuttle between these compartments as it mediates the import of PTS1-containing proteins. PEX5 has been reported to interact with PEX10, PEX12, PEX13, and PEX14. Defects in PEX5 are a cause of Zellweger syndrome (ZWS), which is a lethal peroxisome biogenesis disorder. This antibody recognizes endogenous PEX5, which migrates with an apparent molecular mass of 80 kDa (PMID: 7790377).

Protocols

Product Specific Protocols
FC protocol for PEX5 antibody 12545-1-APDownload protocol
IF protocol for PEX5 antibody 12545-1-APDownload protocol
IHC protocol for PEX5 antibody 12545-1-APDownload protocol
IP protocol for PEX5 antibody 12545-1-APDownload protocol
WB protocol for PEX5 antibody 12545-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Nat Cell Biol

A tuberous sclerosis complex signalling node at the peroxisome regulates mTORC1 and autophagy in response to ROS.

Authors - Zhang Jiangwei J
  • KD Validated
humanWB,IF

Nat Cell Biol

ATM functions at the peroxisome to induce pexophagy in response to ROS.

Authors - Jiangwei Zhang
humanWB,IP,IF

Autophagy

Silencing PEX26 as an unconventional mode to kill drug-resistant cancer cells and forestall drug resistance.

Authors - Michael S Dahabieh
humanWB,IF

Cell Mol Life Sci

Dietary cysteine and methionine promote peroxisome elevation and fat loss by induction of CG33474 expression in Drosophila adipose tissue

Authors - Meng Liu
humanWB

Hum Mol Genet

A novel type of rhizomelic chondrodysplasia punctata, RCDP5, is caused by loss of the PEX5 long isoform.

Authors - Tuva Barøy

Biochim Biophys Acta Mol Cell Biol Lipids

Ceramide regulates interaction of Hsd17b4 with Pex5 and function of peroxisomes.

Authors - Zhihui Zhu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Zhihui (Verified Customer) (12-12-2018)

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEK293T And mouse astrocytes
PEX5 Antibody Western Blot, validation (1:1000 dilution) in HEK293T And mouse astrocytes (Cat no:12545-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...