Tested Applications
| Positive WB detected in | HEK-293 cells, A431 cells, Jurkat cells, mouse heart tissue, mouse thymus tissue, HeLa cells, mouse spleen tissue |
| Positive IP detected in | mouse spleen tissue |
| Positive IHC detected in | human stomach cancer tissue, human kidney tissue, human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:300-1:1200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13763-1-AP targets PFKFB3 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, pig, rabbit, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4744 Product name: Recombinant human PFKFB3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 243-520 aa of BC040482 Sequence: HVQPRTIYLCRHGENEHNLQGRIGGDSGLSSRGKKFASALSKFVEEQNLKDLRVWTSQLKSTIQTAEALRLPYEQWKALNEIDAGVCEELTYEEIRDTYPEEYALREQDKYYYRYPTGESYQDLVQRLEPVIMELERQENVLVICHQAVLRCLLAYFLDKSAEEMPYLKCPLHTVLKLTPVAYGCRVESIYLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHVASTSAALPSCLPPEVPTQLPGQNMKGSRSSADSSRKH Predict reactive species |
| Full Name | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 |
| Calculated Molecular Weight | 520 aa, 60 kDa |
| Observed Molecular Weight | 58 kDa |
| GenBank Accession Number | BC040482 |
| Gene Symbol | PFKFB3 |
| Gene ID (NCBI) | 5209 |
| RRID | AB_2162854 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q16875 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PFKFB3, also named as NY-REN-56 and iPFK-2, plays a role in glucose metabolism. Its synthesis and degradation of fructose 2,6-bisphosphate. Endogenously generated adenosine cooperates with bacterial components to increase PFKFB3 isozyme activity, resulting in greater fructose 2,6-bisphosphate accumulation. PFKFB3 is required for increased growth, metabolic activity and is regulated through active JAK2 and STAT5.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for PFKFB3 antibody 13763-1-AP | Download protocol |
| IP protocol for PFKFB3 antibody 13763-1-AP | Download protocol |
| WB protocol for PFKFB3 antibody 13763-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The PFKFB3 Polyclonal antibody (Cat# 13763-1-AP) has accumulated 208 citations across diverse high-impact journals, including Nature, Cell, Cell Metabolism, Nature Communications, Circulation, Cancer Research, American Journal of Respiratory and Critical Care Medicine, Science Translational Medicine, Oncogene, and Journal of Biological Chemistry. Research fields predominantly encompass glycolytic metabolic reprogramming, oncology (breast, gastric, colorectal, lung, and liver cancers), cardiovascular disease, pulmonary and hepatic fibrosis, neuroinflammation, diabetes, angiogenesis, and sepsis. Applications are primarily Western blot, with IHC, IF, and IP also represented across human, mouse, rat, and other species.
| Species | Application | Title |
|---|---|---|
Circulation Exercise-Induced Changes in Glucose Metabolism Promote Physiologic Cardiac Growth. | ||
Cell Metab Semaglutide ameliorates osteoarthritis progression through a weight loss-independent metabolic restoration mechanism. | ||
Cell Metab CircACC1 Regulates Assembly and Activation of AMPK Complex under Metabolic Stress. | ||
Cell Metab NEAT1 is essential for metabolic changes that promote breast cancer growth and metastasis. |
Reviews
What customers say
All five reviews are for Western Blot applications. Four reviewers rated the antibody 5 out of 5, reporting strong, specific signal at dilutions of 1:1000–1:2000 across colon tissue, colon cancer cell lines, colonic epithelial cells, and PC cell lines. One reviewer gave 4 out of 5, noting a strong band at ~60 kD but a non-specific band near 65–70 kD at a 1:200 dilution in H1299 cells. Overall, users consistently describe the antibody as performing well with good signal intensity for WB.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Balawant (Verified Customer) (08-24-2022) | this antibody is working good for westerner blot.
|
Balawant (Verified Customer) (05-08-2022) | tis antibody is working great at 1:2000 diluton. I have used this antibody from total cells lysate of colonic epithelial cells form human origin.
|
Iram (Verified Customer) (04-13-2022) | Very good signal
|
Susmita (Verified Customer) (03-11-2022) | This antibody works great for me.
|
Hsin-Sheng (Verified Customer) (08-19-2019) | Strong bend intensity at around 60 kD. However, there is a non-specific band near 65-70 kD.
|
