PGLYRP1 Polyclonal antibody

• 

  WB analysis using 18046-1-AP

  Rat brain tissue was subjected to SDS PAGE followed by western blot with 18046-1-AP (PGLYRP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 18046-1-AP

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 18046-1-AP (PGLYRP1 antibody) at dilution of 1:100 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 18046-1-AP

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 18046-1-AP (PGLYRP1 antibody) at dilution of 1:100 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

PGLYRP1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 18046-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

SBBI68, PGRP-S, PGRPS, PGRP S, PGRP

---

Tested Applications

• Positive WB detected in: rat brain tissue
• Positive IHC detected in: human intrahepatic cholangiocarcinoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18046-1-AP targets PGLYRP1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12690

  Product name: Recombinant human PGLYRP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-196 aa of BC101845

  Sequence: MSRRSMLLAWALPSLLRLGAAQETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP

• Full Name: peptidoglycan recognition protein 1
• Calculated Molecular Weight: 196 aa, 22 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC101845
• Gene Symbol: PGLYRP1
• Gene ID (NCBI): 8993
• RRID: AB_3085550
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75594
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Peptidoglycan recognition protein 1 (PGLYRP1, also known as PGRP-S) belongs to a family of evolutionary conserved innate immunity proteins, which in mammals also include PGLYRP2, PGLYRP3, and PGLYRP4 (PMID: 17275309; 20418257). PGLYRP1 is highly expressed in polymorphonuclear leukocytes and to a lower extent in many non-immune cells (PMID: 20418257). It recognizes bacterial peptidoglycan and functions in antibacterial immunity and inflammation (PMID: 20418257). PGLYRP1 has been identified as a ligand for TREM-1 (PMID: 25595774).