PGM2 Polyclonal antibody

• 

  WB analysis using 11022-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11022-1-AP (PGM2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 11022-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 11022-1-AP (PGM2 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 11022-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 11022-1-AP (PGM2 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HEK-293 using 11022-1-AP

  IP result of anti-PGM2 (IP:11022-1-AP, 4ug; Detection:11022-1-AP 1:200) with HEK-293 cells lysate 2400 ug.

• 

  IHC staining of human pancreas cancer using 11022-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 11022-1-AP (PGM2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas cancer using 11022-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 11022-1-AP (PGM2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas cancer using 11022-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 11022-1-AP (PGM2 antibody) at dilution of 1:100 (under 10x lens).

• Featured Product
• KD/KO Validated

PGM2 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 11022-1-AP

Publications(2)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF, IP, ELISA

Synonyms

Glucose phosphomutase 2, MSTP006, PGM 2, PGM2, Phosphodeoxyribomutase, phosphoglucomutase 2, Phosphopentomutase

---

Tested Applications

• Positive WB detected in: HEK-293 cells, human brain tissue, fetal human brain tissue
• Positive IP detected in: HEK-293 cells
• Positive IHC detected in: human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 2 publications below
• IF: See 1 publications below

Product Information

11022-1-AP targets PGM2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1488

  Product name: Recombinant human PGM2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 264-612 aa of BC010087

  Sequence: QSAFKAFDLVPPEAVPEQKDPDPEFPTVKYPNPEEGKGVLTLSFALADKTKARIVLANDPDADRLAVAEKQDSGEWRVFSGNELGALLGWWLFTSWKEKNQDRSALKDTYMLSSTVSSKILRAIALKEGFHFEETLTGFKWMGNRAKQLIDQGKTVLFAFEEAIGYMCCPFVLDKDGVSAAVISAELASFLATKNLSLSQQLKAIYVEYGYHITKASYFICHDQETIKKLFENLRNYDGKNNYPKACGKFEISAIRDLTTGYDDSQPDKKAVLPTSKSSQMITFTFANGGVATMRTSGTEPKIKYYAELCAPPGNSDPEQLKKELNELVSAIEEHFFQPQKYNLQPKAD

• Full Name: phosphoglucomutase 2
• Calculated Molecular Weight: 68 kDa
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: BC010087
• Gene Symbol: PGM2
• Gene ID (NCBI): 55276
• RRID: AB_2161422
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96G03
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Metab; Salvage of ribose from uridine or RNA supports glycolysis in nutrient-limited conditions; Authors - Owen S Skinner ; KO Validated
human	WB,IF	Heliyon; Nuclear translocation of nucleotide enzyme Phosphoglucomutase 2 governs DNA damage response and anti-tumor immunity; Authors - Yingying Lyu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Patricia (Verified Customer) (02-25-2020)

Works well. No non-specific bands.

• Applications: Western Blot,
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Ovarian cancer