PHF17 Polyclonal antibody

• 

  WB analysis of HeLa using 15032-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 15032-1-AP (PHF17 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 15032-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 15032-1-AP (PHF17 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

PHF17 Polyclonal Antibody for WB, ELISA

Cat No. 15032-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IP, CoIP, ELISA

Synonyms

Jade family PHD finger protein 1, JADE1, PHF 17, Protein Jade-1

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 6 publications below
• IHC: See 1 publications below
• IP: See 2 publications below
• CoIP: See 1 publications below

Product Information

15032-1-AP targets PHF17 in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4290

  Product name: Recombinant human PHF17 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-300 aa of BC032376

  Sequence: MKRGRLPSSSEDSDDNGSLSTTWSQNSRSQHRRSSCSRHEDRKPSEVFRTDLITAMKLHDSYQLNPDEYYVLADPWRQEWEKGVQVPVSPGTIPQPVARVVSEEKSLMFIRPKKYIVSSGSEPPELGYVDIRTLADSVCRYDLNDMDAAWLELTNEEFKEMGMPELDEYTMERVLEEFEQRCYDNMNHAIETEEGLGIEYDEDVVCDVCQSPDGEDGNEMVFCDKCNICVHQACYGILKVPEGSWLCRTCALGVQPKCLLCPKKGGAMKPTRSGTKWVHVSCALWIPEVSIGSPEKMEPI

• Full Name: PHD finger protein 17
• Calculated Molecular Weight: 96 kDa
• Observed Molecular Weight: 65 kDa, 100-110 kDa
• GenBank Accession Number: BC032376
• Gene Symbol: PHF17
• Gene ID (NCBI): 79960
• RRID: AB_2165238
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6IE81
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PHF17 was identified as a protein partner of the von Hippel-Lindau tumor suppressor pVHL. It is one component of the HBO1 complex which has a histone H4-specific acetyltransferase activity, a reduced activity toward histone H3 and is responsible for the bulk of histone H4 acetylation in vivo. It can act as a transcriptional coactivator that promote acetylation of nucleosomal histone H4 by KAT5. In addition, it ubiquitinates both phosphorylated and non-phosphorylated β-catenin and therefore regulates canonical Wnt signaling in both Wnt-off and Wnt-on phases. PHF17 exist several isoforms with molecular weight 100-110 and 55-65 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IP,IHC	Acta Neuropathol; Genome-wide association study and functional validation implicates JADE1 in tauopathy.; Authors - Kurt Farrell
human	WB	J Biol Chem; The ciliary protein nephrocystin-4 translocates the canonical Wnt regulator Jade-1 to the nucleus to negatively regulate β-catenin signaling.; Authors - Borgal Lori L
human	WB,IP	J Biol Chem; Casein Kinase 1 Alpha Phosphorylates the Wnt-Regulator Jade-1 and Modulates its Activity.; Authors - Lori Borgal
human	WB	Cell Cycle; Jade-1S phosphorylation induced by CK1α contributes to cell cycle progression.; Authors - Lori Borgal
human	WB	J Toxicol Sci; Involvement of microRNA-4680-3p against phenytoin-induced cell proliferation inhibition in human palate cells; Authors - Yosuke Tsukiboshi
mouse,human	WB,CoIP	bioRxiv; Jade1 and the HBO1 complex are spatial-selective cofactors of Oct4; Authors - Yifan Wu