PIAS1 Monoclonal antibody, PBS Only

• 

  WB analysis using 60498-1-Ig (same clone as 60498-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 60498-1-Ig (PIAS1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60498-1-PBS in a different storage buffer formulation.

• 

  WB analysis of THP-1 using 60498-1-Ig (same clone as 60498-1-PBS)

  THP-1 cells were subjected to SDS PAGE followed by western blot with 60498-1-Ig (PIAS1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60498-1-PBS in a different storage buffer formulation.

PIAS1 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 60498-1-PBS

Clone No.10A12E6

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

EC:2.3.2.-, E3 SUMO-protein transferase PIAS1, E3 SUMO-protein ligase PIAS1, DEAD/H box-binding protein 1, DDXBP1

---

Product Information

60498-1-PBS targets PIAS1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18132

  Product name: Recombinant human PIAS1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 475-651 aa of BC121797

  Sequence: PSAKRTCPSLSPTSPLNNKGILSLPHQASPVSRTPSLPAVDTSYINTSLIQDYRHPFHMTPMPYDLQGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGSTSLPTTNGSSSGSNSSLVSSNSLRESHSHTVTNRSSTDTASIFGIIPDIISLD

• Full Name: protein inhibitor of activated STAT, 1
• Calculated Molecular Weight: 651 aa, 72 kDa
• Observed Molecular Weight: 75 kDa
• GenBank Accession Number: BC121797
• Gene Symbol: PIAS1
• Gene ID (NCBI): 8554
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O75925
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.