Tested Applications
| Positive WB detected in | LNCaP cells, human brain tissue, SH-SY5Y cells, mouse brain tissue, rat brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:5000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 6 publications below |
| IHC | See 4 publications below |
| IF | See 3 publications below |
| CoIP | See 1 publications below |
Product Information
10983-2-AP targets PICK1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1443 Product name: Recombinant human PICK1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-415 aa of BC017561 Sequence: MFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKKVKHRLVENMSSGTADALGLSRAILCNDGLVKRLEELERTAELYKGMTEHTKNLLRAFYELSQTHRAFGDVFSVIGVREPQPAASEAFVKFADAHRSIEKFGIRLLKTIKPMLTDLNTYLNKAIPDTRLTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRLVSTMSKYYNDCYAVLRDADVFPIEVDLAHTTLAYGLNQEEFTDGEEEEEEEDTAAGEPSRDTRGAAGPLDKGGSWCDS Predict reactive species |
| Full Name | protein interacting with PRKCA 1 |
| Calculated Molecular Weight | 47 kDa |
| Observed Molecular Weight | 50-55 kDa |
| GenBank Accession Number | BC017561 |
| Gene Symbol | PICK1 |
| Gene ID (NCBI) | 9463 |
| RRID | AB_2164525 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NRD5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Protein interacting with C kinase 1 (PICK1) was first cloned as a PKC-binding partner through yeast two hybrid system. PICK1 acts as a critical regulator of membrane receptors' subcellular trafficking to modulate neural processes such as learning and memory, and is widely expressed in brain, testis, heart, lung, liver, kidney and muscle. It probably binds to and organize the subcellular localization of a variety of membrane proteins containing some PDZ recognition sequence, for instance, PICK1 is a critical mediator of α-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid receptor (AMPAR) trafficking in neural synapses. PICK1 expression on D-serine release and glutamate transport in astrocytes suggests a potential implication of PICK1 in the progression of amyotrophic lateral sclerosis (ALS). PICK1 may also participate in breast cancer development through inhibition of TGF-β signaling.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PICK1 antibody 10983-2-AP | Download protocol |
| IHC protocol for PICK1 antibody 10983-2-AP | Download protocol |
| IP protocol for PICK1 antibody 10983-2-AP | Download protocol |
| WB protocol for PICK1 antibody 10983-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Res PICK1 promotes caveolin-dependent degradation of TGF-β type I receptor.
| ||
Cell Death Dis PICK1 inhibits the malignancy of nasopharyngeal carcinoma and serves as a novel prognostic marker | ||
Environ Int Repression of autophagy leads to acrosome biogenesis disruption caused by a sub-chronic oral administration of polystyrene nanoparticles. | ||
Biofactors Exploring vimentin's role in breast cancer via PICK1 alternative polyadenylation and the miR-615-3p-PICK1 interaction | ||
Front Neuroanat Deletion of KIBRA, protein expressed in kidney and brain, increases filopodial-like long dendritic spines in neocortical and hippocampal neurons in vivo and in vitro. | ||
Cancer Sci Protein interacting with C alpha kinase 1 (PICK1) is involved in promoting tumor growth and correlates with poor prognosis of human breast cancer. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Ambra (Verified Customer) (01-20-2021) | I used this rabbit anti-Pick 1:1000 in 5% milk in TBS-T on lysates from human brain (temporal cortex).NOTE: 1 clear band is visible using a 15% acrylamide gel. Lower gel percentage (10%) give a duplet band.
|













