Filter: AllIHC

IHC staining of human breast cancer using 16068-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 16068-1-AP (GCDFP-15/PIP antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human breast cancer using 16068-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 16068-1-AP (GCDFP-15/PIP antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human breast cancer using 16068-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer using 16068-1-AP (GCDFP-15/PIP antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human breast cancer using 16068-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer using 16068-1-AP (GCDFP-15/PIP antibody) at dilution of 1:50 (under 40x lens).
IHC staining of human breast cancer using 16068-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer using 16068-1-AP (GCDFP-15/PIP antibody) at dilution of 1:50 (under 40x lens).
IHC staining of human breast cancer using 16068-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer using 16068-1-AP (GCDFP-15/PIP antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human breast cancer using 16068-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer using 16068-1-AP (GCDFP-15/PIP antibody) at dilution of 1:50 (under 40x lens).
IHC staining of human breast cancer using 16068-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer using 16068-1-AP (GCDFP-15/PIP antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human breast cancer using 16068-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer using 16068-1-AP (GCDFP-15/PIP antibody) at dilution of 1:50 (under 40x lens).
IHC staining of human breast cancer using 16068-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer using 16068-1-AP (GCDFP-15/PIP antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human breast cancer using 16068-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer using 16068-1-AP (GCDFP-15/PIP antibody) at dilution of 1:50 (under 40x lens).
IHC staining of human breast cancer using 16068-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer using 16068-1-AP (GCDFP-15/PIP antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human breast cancer using 16068-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer using 16068-1-AP (GCDFP-15/PIP antibody) at dilution of 1:50 (under 40x lens).
IHC staining of human breast cancer using 16068-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer using 16068-1-AP (GCDFP-15/PIP antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human breast cancer using 16068-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer using 16068-1-AP (GCDFP-15/PIP antibody) at dilution of 1:50 (under 40x lens).
IHC staining of human breast using 16068-1-AP
Immunohistochemical analysis of paraffin-embedded human breast tissue slide using 16068-1-AP (GCDFP-15/PIP antibody at dilution of 1:50 (under 10x lens).
IHC staining of human breast using 16068-1-AP
Immunohistochemical analysis of paraffin-embedded human breast tissue slide using 16068-1-AP (GCDFP-15/PIP antibody at dilution of 1:50 (under 40x lens).
IHC staining of human skin using 16068-1-AP
Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 16068-1-AP (GCDFP-15/PIP antibody at dilution of 1:200 (under 10x lens).
IHC staining of human skin using 16068-1-AP
Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 16068-1-AP (GCDFP-15/PIP antibody at dilution of 1:200 (under 40x lens).
IHC staining of human breast cancer using 16068-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 16068-1-AP (GCDFP-15/PIP antibody at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human breast cancer using 16068-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 16068-1-AP (GCDFP-15/PIP antibody at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

GCDFP-15/PIP Polyclonal antibody

Name: GCDFP-15/PIP Polyclonal antibody
Brand: Proteintech
SKU: 16068-1-AP

GCDFP-15/PIP Polyclonal Antibody for IHC, ELISA

Cat No. 16068-1-AP

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

GCDFP 15, GCDFP15, gp17, GPIP4, PIP, prolactin induced protein, Prolactin inducible protein, SABP

Formulation: PBS and Azide

PBS and Azide

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive IHC detected in

human breast cancer tissue, human skin tissue, human breast tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

Application	Dilution
Immunohistochemistry (IHC)	IHC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16068-1-AP targets GCDFP-15/PIP in IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag9004 Product name: Recombinant human GCDFP-15, PIP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 28-146 aa of BC010950 Sequence: AQDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE Predict reactive species
Full Name	prolactin-induced protein
Calculated Molecular Weight	146 aa, 17 kDa
GenBank Accession Number	BC010950
Gene Symbol	GCDFP-15
Gene ID (NCBI)	5304
RRID	AB_2878212
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P12273
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GCDFP-15 (gross cystic disease fluid protein 15), also known as PIP (prolactin-induced protein) is a secretory glycoprotein expressed in benign and malignant breast tumor tissues and in some normal exocrine organs such as sweat, salivary, and lacrimal glands (PMID: 12393800). GCDFP-15 expression is increased by prolactin and androgen and inhibited by estrogen (PMID: 18854942). The expression is also regulated by interleukins. GCDFP-15 is a marker of apocrine differentiation and is frequently used for assessment of metastases or regional recurrences of breast origin.