Tested Applications
| Positive IHC detected in | human skin tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
60210-1-Ig targets GCDFP-15/PIP in IHC, IF, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | bovine |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8980 Product name: Recombinant human GCDFP-15, PIP protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 28-146 aa of BC010950 Sequence: AQDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE Predict reactive species |
| Full Name | prolactin-induced protein |
| Calculated Molecular Weight | 146 aa, 17 kDa |
| GenBank Accession Number | BC010950 |
| Gene Symbol | GCDFP-15 |
| Gene ID (NCBI) | 5304 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P12273 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GCDFP-15 (gross cystic disease fluid protein 15), also known as PIP (prolactin-induced protein) is a secretory glycoprotein expressed in benign and malignant breast tumor tissues and in some normal exocrine organs such as sweat, salivary, and lacrimal glands (PMID: 12393800). GCDFP-15 expression is increased by prolactin and androgen and inhibited by estrogen (PMID: 18854942). The expression is also regulated by interleukins. GCDFP-15 is a marker of apocrine differentiation and is frequently used for assessment of metastases or regional recurrences of breast origin.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for GCDFP-15/PIP antibody 60210-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The GCDFP-15/PIP Monoclonal antibody (4F5C11), catalog number 60210-1-Ig, has a total of 1 citation. The citation appears in the journal Theriogenology (2014) and is associated with reproductive biology research, specifically the identification of bovine prolactin in seminal fluid and the expression/localization of the prolactin receptor and prolactin-inducible protein in bull testis and epididymis exposed to ergot alkaloids. The antibody was used for immunofluorescence (IF) in bovine samples.
| Species | Application | Title |
|---|---|---|
Theriogenology Identification of bovine prolactin in seminal fluid, and expression and localization of the prolactin receptor and prolactin-inducible protein in the testis and epididymis of bulls exposed to ergot alkaloids. |
