PKMYT1 Monoclonal antibody, PBS Only

• 

  WB analysis using 67806-1-Ig (same clone as 67806-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67806-1-Ig (PKMYT1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 67806-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 67806-1-Ig (same clone as 67806-1-PBS)

  WB result of PKMYT1 antibody (67806-1-Ig; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PKMYT1 transfected MCF-7 cells. This data was developed using the same antibody clone with 67806-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 67806-1-Ig (same clone as 67806-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67806-1-Ig (PKMYT1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67806-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 67806-1-Ig (same clone as 67806-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67806-1-Ig (PKMYT1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67806-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PKMYT1 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67806-1-PBS

Clone No.1D12D3

Host / Isotype

Mouse / IgG2a

Reactivity

Human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

DKFZp547K1610, FLJ20093, MYT1, Myt1 kinase, PKMYT1

---

Product Information

67806-1-PBS targets PKMYT1 in WB, IHC, Indirect ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30849

  Product name: Recombinant human PKMYT1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-180 aa of NM_004203

  Sequence: MLERPPALAMPMPTEGTPPPLSGTPIPVPAYFRHAEPGFSLKRPRGLSRSLPPPPPAKGSIPISRLFPPRTPGWHQLQPRRVSFRGEASETLQSPGYDPSRPESFFQQSFQRLSRLGHGSYGEVFKVRSKEDGRLYAVKRSMSPFRGPKDRARKLAEVGSHEKVGQHPCCVRLEQAWEEG

• Full Name: protein kinase, membrane associated tyrosine/threonine 1
• Calculated Molecular Weight: 55 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: NM_004203
• Gene Symbol: PKMYT1
• Gene ID (NCBI): 9088
• RRID: AB_2918569
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q99640
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Protein kinase, membrane associated tyrosine/threonine (PKMYT1) is a member of the Wee family of protein kinases. PKMYT1 acts as a negative regulator of the cell cycle by inactivating the CDK1-cyclinB complex through phosphorylation of Tyr14/Tyr15 and preventing cell cycle entering into mitosis at the G2/M transition. In mammalian somatic cells, PKMYT1 affects the assembly of the Golgi apparatus and endoplasmic reticulum during telophase of mitosis by inhibiting cyclin activities. Abnormal expression of PKMYT1 is closely associated with multiple types of cancers. PKMYT1 protein was mainly localized in the cytoplasm. (PMID: 31695486, PMID: 32801781)