• Featured Product
  • KD/KO Validated

PKMYT1 Monoclonal antibody, PBS Only

PKMYT1 Monoclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 67806-1-PBS
Clone No.1D12D3

Host / Isotype

Mouse / IgG2a

Reactivity

Human, mouse, rat

Applications

WB, IHC, Indirect ELISA

DKFZp547K1610, FLJ20093, MYT1, Myt1 kinase, PKMYT1

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67806-1-PBS targets PKMYT1 in WB, IHC, Indirect ELISA applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30849

Product name: Recombinant human PKMYT1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-180 aa of NM_004203

Sequence: MLERPPALAMPMPTEGTPPPLSGTPIPVPAYFRHAEPGFSLKRPRGLSRSLPPPPPAKGSIPISRLFPPRTPGWHQLQPRRVSFRGEASETLQSPGYDPSRPESFFQQSFQRLSRLGHGSYGEVFKVRSKEDGRLYAVKRSMSPFRGPKDRARKLAEVGSHEKVGQHPCCVRLEQAWEEG

Predict reactive species
Full Name protein kinase, membrane associated tyrosine/threonine 1
Calculated Molecular Weight 55 kDa
Observed Molecular Weight 55 kDa
GenBank Accession NumberNM_004203
Gene Symbol PKMYT1
Gene ID (NCBI) 9088
RRIDAB_2918569
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ99640
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Protein kinase, membrane associated tyrosine/threonine (PKMYT1) is a member of the Wee family of protein kinases. PKMYT1 acts as a negative regulator of the cell cycle by inactivating the CDK1-cyclinB complex through phosphorylation of Tyr14/Tyr15 and preventing cell cycle entering into mitosis at the G2/M transition. In mammalian somatic cells, PKMYT1 affects the assembly of the Golgi apparatus and endoplasmic reticulum during telophase of mitosis by inhibiting cyclin activities. Abnormal expression of PKMYT1 is closely associated with multiple types of cancers. PKMYT1 protein was mainly localized in the cytoplasm. (PMID: 31695486, PMID: 32801781)

Loading...
||
New chat Able
正在加载,请稍候...