t-Plasminogen activator/tPA Polyclonal antibody

• 

  WB analysis using 10147-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10147-1-AP (tPA antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse kidney using 10147-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 10147-1-AP (tPA antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse pancreas using 10147-1-AP

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 10147-1-AP (tPA antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse pancreas using 10147-1-AP

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 10147-1-AP (tPA antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse kidney using 10147-1-AP

  IP result of anti-tPA (IP:10147-1-AP, 3ug; Detection:10147-1-AP 1:1000) with mouse kidney tissue lysate 4000ug.

• 

  IHC staining of mouse brain using 10147-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 10147-1-AP (tPA antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 10147-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 10147-1-AP (tPA antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse brain using 10147-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using tPA antibody (10147-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

t-Plasminogen activator/tPA Polyclonal Antibody for WB, IHC, IF-P, IP, ELISA

Cat No. 10147-1-AP

Publications(31)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IP, ELISA

Synonyms

PLAT, tPA, T PA, Reteplase, EC:3.4.21.68

---

Tested Applications

• Positive WB detected in: mouse kidney tissue, mouse pancreas tissue, rat kidney tissue
• Positive IP detected in: mouse kidney tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 18 publications below
• IHC: See 6 publications below
• IF: See 11 publications below

Product Information

10147-1-AP targets t-Plasminogen activator/tPA in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0200

  Product name: Recombinant human PLAT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 359-516 aa of BC002795

  Sequence: NDIALLQLKSDSSRCAQESSVVRTVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLKEAHVRLYPSSRCTSQHLLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWGLGCGQKDVPGVYTKVTNYLDWIRDNMRP

• Full Name: plasminogen activator, tissue
• Calculated Molecular Weight: 57 kDa
• Observed Molecular Weight: 32-35 kDa, 65 kDa
• GenBank Accession Number: BC002795
• Gene Symbol: tPA
• Gene ID (NCBI): 5327
• RRID: AB_2299701
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P00750
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Plasminogen activator, tissue (PLAT, synonyms: TPA, T-PA) is a tissue-type plasminogen activator, a secreted serine protease which converts the proenzyme plasminogen to plasmin, a fibrinolytic enzyme. Tissue-type plasminogen activator is synthesized as a single chain which is cleaved by plasmin to a two chain disulfide linked protein (33 kDa and 32 kDa). PLAT enzyme plays a role in cell migration and tissue remodeling. Increased enzymatic activity causes hyperfibrinolysis, which manifests as excessive bleeding; decreased activity leads to hypofibrinolysis which can result in thrombosis or embolism. tPA has 4 isoforms produced by alternative splicing with the MW of 63 kDa, 33 kDa, 57 kDa and 44 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Acta Neuropathol; TAM receptors mediate the Fpr2-driven pain resolution and fibrinolysis after nerve injury; Authors - Beate Hartmannsberger
mouse	WB,IF	Redox Biol; FUNDC1-dependent mitophagy induced by tPA protects neurons against cerebral ischemia-reperfusion injury.; Authors - Ying Cai ; KO Validated
mouse	IF	J Neurosci; Tissue plasminogen activator contributes to alterations of neuronal migration and activity-dependent responses in fragile x mice.; Authors - V Swaroop Achuta
human	WB	Aging (Albany NY); NFAT5 directs hyperosmotic stress-induced fibrin deposition and macrophage infiltration via PAI-1 in endothelium.; Authors - Pingping Ma
mouse	IHC	Glia; Lipoprotein receptor loss in forebrain radial glia results in neurological deficits and severe seizures.; Authors - Ewa E Bres
human	WB	Sci Rep; Development of a Biomimetic Chondroitin Sulfate-modified Hydrogel to Enhance the Metastasis of Tumor Cells.; Authors - Yang Liu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

nuo (Verified Customer) (08-22-2021)

There is a band at around 64 kD as expected, although there were other nonspecific bindings.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: mouse brain lysate

t-Plasminogen activator/tPA Antibody Western Blot validation (1:1000 dilution) in mouse brain lysate (Cat no:10147-1-AP)