PLCD4 Polyclonal antibody, PBS Only

• 

  WB analysis of HeLa using 30133-1-AP (same clone as 30133-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 30133-1-AP (PLCD4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30133-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 30133-1-AP (same clone as 30133-1-PBS)

  WB result of PLCD4 antibody (30133-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PLCD4 transfected HeLa cells. This data was developed using the same antibody clone with 30133-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat testis using 30133-1-AP (same clone as 30133-1-PBS)

  rat testis tissue were subjected to SDS PAGE followed by western blot with 30133-1-AP (PLCD4 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30133-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 30133-1-AP (same clone as 30133-1-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 30133-1-AP (PLCD4 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30133-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 30133-1-AP (same clone as 30133-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 30133-1-AP (PLCD4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30133-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 30133-1-AP (same clone as 30133-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 30133-1-AP (PLCD4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30133-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PLCD4 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 30133-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

30133-1-PBS targets PLCD4 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32651

  Product name: Recombinant human PLCD4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-290 aa of BC006355

  Sequence: MASLLQDQLTTDQDLLLMQEGMPMRKVRSKSWKKLRYFRLQNDGMTVWHARQARGSAKPSFSISDVETIRNGHDSELLRSLAEELPLEQGFTIVFHGRRSNLDLMANSVEEAQIWMRGLQLLVDLVTSMDHQERLDQWLSDWFQRGDKNQDGKMSFQEVQRLLHLMNVEMDQEYAFSLFQAADTSQSGTLEGEEFVQFYKALTKRAEVQELFESFSADGQKLTLLEFLDFLQEEQKERDCTSELALELIDRYEPSDSGKLRHVLSMDGFLSYLCSKDGDIFNPACLPIYQ

• Full Name: phospholipase C, delta 4
• Calculated Molecular Weight: 85-90 kDa
• Observed Molecular Weight: 90 kDa
• GenBank Accession Number: BC006355
• Gene Symbol: PLCD4
• Gene ID (NCBI): 84812
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BRC7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PLCD4(1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4), also known as hPLCD4. It is highly expressed in skeletal muscle and kidney tissues. It may be an important enzyme for intracellular Ca²⁺ mobilization in the zona pellucida-induced acrosome reaction. PLCD4 cooperates with nuclear PKC to regulate liver regeneration. Overexpression of PLCD4 upregulates Erk signaling pathway and proliferation (PMID: 15140260).