Product Information
60659-2-PBS targets Phospholamban as part of a matched antibody pair:
MP50943-1: 60659-1-PBS capture and 60659-2-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG2a |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag8632 Product name: Recombinant human PLN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-52 aa of BC005269 Sequence: MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL Predict reactive species |
Full Name | phospholamban |
Calculated Molecular Weight | 52 aa, 6 kDa |
GenBank Accession Number | BC005269 |
Gene Symbol | PLN |
Gene ID (NCBI) | 5350 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A Magarose purification |
UNIPROT ID | P26678 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |