Use Able AI chat for product recommendations

PLSCR3 Polyclonal antibody

PLSCR3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28028-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, Mouse, rat and More (1)

Applications

WB, IHC, ELISA

phospholipid scramblase 3, PL scramblase 3, PLSCR3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse kidney tissue, A431 cells, mouse liver tissue, mouse lung tissue, rat kidney tissue, rat liver tissue, rat lung tissue, BxPC-3 cells
Positive IHC detected inhuman liver cancer tissue, human breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

28028-1-AP targets PLSCR3 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse, rat samples.

Tested Reactivity Human, Mouse, rat
Cited Reactivitymouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag27655

Product name: Recombinant human PLSCR3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-295 aa of BC011735

Sequence: MAGYLPPKGYAPSPPPPYPVTPGYPEPALHPGPGQAPVPAQVPAPAPGFALFPSPGPVALGSAAPFLPLPGVPSGLEFLVQIDQILIHQKAERVETFLGWETCNRYELRSGAGQPLGQAAEESNCCARLCCGARRPLRVRLADPGDRELLRLLRPLHCGCSCCPCGLQEMEVQAPPGTTIGHVLQTWHPFLPKFSIQDADRQTVLRVVGPCWTCGCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFGLQFPLDLDVRVKAVLLGATFLIDYMFFEKRGGAGPSAITS

Predict reactive species
Full Name phospholipid scramblase 3
Calculated Molecular Weight 32 kDa
Observed Molecular Weight 32 kDa
GenBank Accession NumberBC011735
Gene Symbol PLSCR3
Gene ID (NCBI) 57048
RRIDAB_2881040
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9NRY6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PLSCR3, also named as PLS3, belongs to the phospholipid scramblase family. It may mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane. PLSCR3 may play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system. It is a target of protein kinase C-δ (PKC-δ), resides in mitochondria and plays pivotal roles in regulating apoptotic response. Phosphorylation of PLSCR3 by PKC-δ is involved in the hyperthermia-induced apoptotic signal transduction pathway in Tca8113 cells, and that Hsp27 blocks this pathway to suppress hyperthermia-induced apoptosis. (PMID:20569108)

Protocols

Product Specific Protocols
IHC protocol for PLSCR3 antibody 28028-1-APDownload protocol
WB protocol for PLSCR3 antibody 28028-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
WB

Mol Cell

The human antibacterial factor APOL3 couples lysosomal damage to mitochondrial DNA efflux and type I IFN induction

Authors - Dominic A Ritacco
mouseWB

Front Mol Neurosci

Cardiolipin externalization mediates prion protein (PrP) peptide 106-126-associated mitophagy and mitochondrial dysfunction

Authors - Dongming Yang

J Am Soc Nephrol

Genome-Wide CRISPR Screen Identifies Phospholipid Scramblase 3 as the Biological Target of Mitoprotective Drug SS-31

Authors - Josie A Silvaroli

Autophagy

TGFB signaling induces mitophagy via PLSCR3-mediated cardiolipin externalization in conjunction with a BNIP3L/NIX-, BNIP3-, and FUNDC1-dependent mechanism

Authors - Jiong Yan

Reviews

    4.0 out of 5
Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Elsa (Verified Customer) (05-06-2019)

the antibody is clean and give a detectable band at the expected molecular weight. Good antibody for mouse PLSCR3.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1/2500
  • Cell Tissue Type: mouse microglia cell line
Loading...
||
New chat

Able

正在加载,请稍候...