PLSCR3 Polyclonal antibody

PLSCR3 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 28028-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, Mouse, rat and More (1)

Applications

WB, IHC, ELISA

phospholipid scramblase 3, PL scramblase 3, PLSCR3

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse kidney tissue, A431 cells, mouse liver tissue, mouse lung tissue, rat kidney tissue, rat liver tissue, rat lung tissue, BxPC-3 cells
Positive IHC detected inhuman liver cancer tissue, human breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

28028-1-AP targets PLSCR3 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse, rat samples.

Tested Reactivity Human, Mouse, rat
Cited Reactivitymouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag27655

Product name: Recombinant human PLSCR3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-295 aa of BC011735

Sequence: MAGYLPPKGYAPSPPPPYPVTPGYPEPALHPGPGQAPVPAQVPAPAPGFALFPSPGPVALGSAAPFLPLPGVPSGLEFLVQIDQILIHQKAERVETFLGWETCNRYELRSGAGQPLGQAAEESNCCARLCCGARRPLRVRLADPGDRELLRLLRPLHCGCSCCPCGLQEMEVQAPPGTTIGHVLQTWHPFLPKFSIQDADRQTVLRVVGPCWTCGCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFGLQFPLDLDVRVKAVLLGATFLIDYMFFEKRGGAGPSAITS

Predict reactive species
Full Name phospholipid scramblase 3
Calculated Molecular Weight 32 kDa
Observed Molecular Weight 32 kDa
GenBank Accession NumberBC011735
Gene Symbol PLSCR3
Gene ID (NCBI) 57048
RRIDAB_2881040
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9NRY6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PLSCR3, also named as PLS3, belongs to the phospholipid scramblase family. It may mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane. PLSCR3 may play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system. It is a target of protein kinase C-δ (PKC-δ), resides in mitochondria and plays pivotal roles in regulating apoptotic response. Phosphorylation of PLSCR3 by PKC-δ is involved in the hyperthermia-induced apoptotic signal transduction pathway in Tca8113 cells, and that Hsp27 blocks this pathway to suppress hyperthermia-induced apoptosis. (PMID:20569108)

Protocols

Product Specific Protocols
WB protocol for PLSCR3 antibody 28028-1-APDownload protocol
IHC protocol for PLSCR3 antibody 28028-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Front Mol Neurosci

Cardiolipin externalization mediates prion protein (PrP) peptide 106-126-associated mitophagy and mitochondrial dysfunction

Authors - Dongming Yang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Elsa (Verified Customer) (05-06-2019)

the antibody is clean and give a detectable band at the expected molecular weight. Good antibody for mouse PLSCR3.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1/2500
  • Cell Tissue Type: mouse microglia cell line
Loading...
||
New chat Able
正在加载,请稍候...