Tested Applications
| Positive WB detected in | mouse kidney tissue, A431 cells, mouse liver tissue, mouse lung tissue, rat kidney tissue, rat liver tissue, rat lung tissue, BxPC-3 cells |
| Positive IHC detected in | human liver cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
28028-1-AP targets PLSCR3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27655 Product name: Recombinant human PLSCR3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-295 aa of BC011735 Sequence: MAGYLPPKGYAPSPPPPYPVTPGYPEPALHPGPGQAPVPAQVPAPAPGFALFPSPGPVALGSAAPFLPLPGVPSGLEFLVQIDQILIHQKAERVETFLGWETCNRYELRSGAGQPLGQAAEESNCCARLCCGARRPLRVRLADPGDRELLRLLRPLHCGCSCCPCGLQEMEVQAPPGTTIGHVLQTWHPFLPKFSIQDADRQTVLRVVGPCWTCGCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFGLQFPLDLDVRVKAVLLGATFLIDYMFFEKRGGAGPSAITS Predict reactive species |
| Full Name | phospholipid scramblase 3 |
| Calculated Molecular Weight | 32 kDa |
| Observed Molecular Weight | 32 kDa |
| GenBank Accession Number | BC011735 |
| Gene Symbol | PLSCR3 |
| Gene ID (NCBI) | 57048 |
| RRID | AB_2881040 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NRY6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PLSCR3, also named as PLS3, belongs to the phospholipid scramblase family. It may mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane. PLSCR3 may play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system. It is a target of protein kinase C-δ (PKC-δ), resides in mitochondria and plays pivotal roles in regulating apoptotic response. Phosphorylation of PLSCR3 by PKC-δ is involved in the hyperthermia-induced apoptotic signal transduction pathway in Tca8113 cells, and that Hsp27 blocks this pathway to suppress hyperthermia-induced apoptosis. (PMID:20569108)
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for PLSCR3 antibody 28028-1-AP | Download protocol |
| WB protocol for PLSCR3 antibody 28028-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The antibody is anti-PLSCR3 (Phospholipid Scramblase 3), catalog number 28028-1-AP. It has a total of 4 citations. These appear in the journals Autophagy, Molecular Cell, Journal of the American Society of Nephrology, and Frontiers in Molecular Neuroscience. The associated research fields include mitophagy and autophagy, mitochondrial biology and cardiolipin externalization, innate immunity and type I interferon induction, nephrology, and prion-related mitochondrial dysfunction.
| Species | Application | Title |
|---|---|---|
Autophagy TGFB signaling induces mitophagy via PLSCR3-mediated cardiolipin externalization in conjunction with a BNIP3L/NIX-, BNIP3-, and FUNDC1-dependent mechanism | ||
Mol Cell The human antibacterial factor APOL3 couples lysosomal damage to mitochondrial DNA efflux and type I IFN induction | ||
J Am Soc Nephrol Genome-Wide CRISPR Screen Identifies Phospholipid Scramblase 3 as the Biological Target of Mitoprotective Drug SS-31 | ||
Front Mol Neurosci Cardiolipin externalization mediates prion protein (PrP) peptide 106-126-associated mitophagy and mitochondrial dysfunction |
Reviews
What customers say
The single review reports a 4-star rating for this antibody used in Western Blot on a mouse microglia cell line at a 1:2500 dilution. The reviewer found the antibody to be clean, producing a detectable band at the expected molecular weight, and described it as a good antibody for mouse PLSCR3. Overall, the feedback is positive, highlighting reliable specificity and performance for its intended application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Elsa (Verified Customer) (05-06-2019) | the antibody is clean and give a detectable band at the expected molecular weight. Good antibody for mouse PLSCR3.
|
