PMS1 Polyclonal antibody, PBS Only

• 

  WB analysis using 28186-1-AP (same clone as 28186-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28186-1-AP (PMS1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28186-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 28186-1-AP (same clone as 28186-1-PBS)

  WB result of PMS1 antibody (28186-1-AP; 1:20000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PMS1 transfected HepG2 cells. This data was developed using the same antibody clone with 28186-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 28186-1-AP (same clone as 28186-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 28186-1-AP (PMS1 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28186-1-PBS in a different storage buffer formulation.

• 

  IF Staining of Caco-2 using 28186-1-AP (same clone as 28186-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Caco-2 cells using PMS1 antibody (28186-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 28186-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PMS1 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 28186-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

HNPCC3, hPMS1, MLH2, PMSL1

---

Product Information

28186-1-PBS targets PMS1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28132

  Product name: Recombinant human PMS1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 340-616 aa of BC096331

  Sequence: LPSTNSYENNKTDVSAADIVLSKTAETDVLFNKVESSGKNYSNVDTSVIPFQNDMHNDESGKNTDDCLNHQISIGDFGYGHCSSEISNIDKNTKNAFQDISMSNVSWENSQTEYSKTCFISSVKHTQSENGNKDHIDESGENEEEAGLENSSEISADEWSRGNILKNSVGENIEPVKILVPEKSLPCKVSNNNYPIPEQMNLNEDSCNKKSNVIDNKSGKVTAYDLLSNRVIKKPMSASALFVQDHRPQFLIENPKTSLEDATLQIEELWKTLSEEE

• Full Name: PMS1 postmeiotic segregation increased 1 (S. cerevisiae)
• Observed Molecular Weight: 106 kDa
• GenBank Accession Number: BC096331
• Gene Symbol: PMS1
• Gene ID (NCBI): 5378
• RRID: AB_2881083
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P54277
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PMS1 Homolog 1 is a member of the DNA mismatch repair enzymes (MMREs) which is to eliminate the mismatch of insertions and deletions as a consequence of DNA polymerase errors at DNA synthesis in eukaryotes. PMS1 and MLH1 could form a heterodimer MutLβ that belongs to MMREs (PMID:25619773). In the MMR system, the MutS complex recognizes the DNA mispairs firstly, and then the Mlh1-Pms1 and other associated proteins such as PCNA, RFC, ExoI were recruited, inducing Exonuclease 1 (Exo1)-dependent and -independent MMR pathways (PMID:24981171). Mutations in this gene cause hereditary nonpolyposis colorectal cancer(HNPCC), which is also known as Lynch syndrome. It was reported that PMS1 is a widely expressed protein and located in the nucleus. Alternative splicing allows for 4 isoforms of PMS1 protein.