POLR1D Polyclonal antibody, PBS Only

• 

  WB analysis of HeLa using 12254-1-AP (same clone as 12254-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 12254-1-AP (POLR1D antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12254-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 12254-1-AP (same clone as 12254-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 12254-1-AP (POLR1D antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12254-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse lung using 12254-1-AP (same clone as 12254-1-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 12254-1-AP (POLR1D antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12254-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 12254-1-AP (same clone as 12254-1-PBS)

  IP result of anti-POLR1D (IP:12254-1-AP, 4ug; Detection:12254-1-AP 1:500) with HeLa cells lysate 2600 ug. This data was developed using the same antibody clone with 12254-1-PBS in a different storage buffer formulation.

POLR1D Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 12254-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

---

Product Information

12254-1-PBS targets POLR1D in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2904

  Product name: Recombinant human POLR1D protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-122 aa of BC015319

  Sequence: MEEDQELERKAIEELLKEAKRGKTRAETMGPMGWMKCPLASTNKRFLINTIKNTLPSHKEQDHEQKEGDKEPAKSQAQKEENPKKHRSHPYKHSFRARGSASYSPPRKRSSQDKYEKRSNRR

• Full Name: polymerase (RNA) I polypeptide D, 16kDa
• Calculated Molecular Weight: 16 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC015319
• Gene Symbol: POLR1D
• Gene ID (NCBI): 51082
• RRID: AB_10640535
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P0DPB6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.