POLR1D Polyclonal antibody

• 

  WB analysis of HeLa using 12254-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 12254-1-AP (POLR1D antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 12254-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 12254-1-AP (POLR1D antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse lung using 12254-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 12254-1-AP (POLR1D antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 12254-1-AP

  IP result of anti-POLR1D (IP:12254-1-AP, 4ug; Detection:12254-1-AP 1:500) with HeLa cells lysate 2600 ug.

POLR1D Polyclonal Antibody for WB, IP, ELISA

Cat No. 12254-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, ELISA

Synonyms

AC19, hRPA19, POLR1C, POLR1D, RPA16, RPA9, RPAC2, RPC16, RPO1 3

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cells, mouse lung tissue
• Positive IP detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

12254-1-AP targets POLR1D in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2904

  Product name: Recombinant human POLR1D protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-122 aa of BC015319

  Sequence: MEEDQELERKAIEELLKEAKRGKTRAETMGPMGWMKCPLASTNKRFLINTIKNTLPSHKEQDHEQKEGDKEPAKSQAQKEENPKKHRSHPYKHSFRARGSASYSPPRKRSSQDKYEKRSNRR

• Full Name: polymerase (RNA) I polypeptide D, 16kDa
• Calculated Molecular Weight: 16 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC015319
• Gene Symbol: POLR1D
• Gene ID (NCBI): 51082
• RRID: AB_10640535
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P0DPB6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Sci Adv; Ribosome changes reprogram translation for chemosurvival in G0 leukemic cells; Authors - Chandreyee Datta